DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or56a

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:447 Identity:89/447 - (19%)
Similarity:170/447 - (38%) Gaps:106/447 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDFKLNTHSAVYYHWRVWELTGLMRPPGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFTTNMAG 69
            ||....||.. |:.|..:..:.....|.:|.:...:.:.::.|...:     :|||:.  .....
  Fly    15 EDPIFGTHLR-YFQWYGYVASKDQNRPLLSLIRCTILTASIWLSCAL-----MLARVF--RGYEN 71

  Fly    70 LCENLTITITDI---VANLKFANVYMVRKQLHEIRSLLRLMDARARLVGDPEEISALRKEVNIA- 130
            |.:..|...|.:   ..::...|.|:   |..::.||||:  |.:.:.....|......|:.:| 
  Fly    72 LNDGATSYATAVQYFAVSIAMFNAYV---QRDKVISLLRV--AHSDIQNLMHEADNREMELLVAT 131

  Fly   131 QGTFRTFASIFVFGTTLS-------CVRVVVRPDRELLYP-AWFGVDWMHSTRNYVLINIYQLF- 186
            |...||...:....:.::       |:.      |.|..| :.|.|..:.....:.:: ::||| 
  Fly   132 QAYTRTITLLIWIPSVIAGLMAYSDCIY------RSLFLPKSVFNVPAVRRGEEHPIL-LFQLFP 189

  Fly   187 -------------------GLIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSN- 231
                               ||.:.||         |.:...:|..|:.:.|:::.:..|.|:.: 
  Fly   190 FGELCDNFVVGYLGPWYALGLGITAI---------PLWHTFITCLMKYVNLKLQILNKRVEEMDI 245

  Fly   232 ------------KGQTYEAWREEVYQELIECIRDLARVHRLREIIQRVLSVPCMAQFVCSAAVQC 284
                        .......|:.::::|.   :::..|:.:..:.:|.::.||.||.|:..:.:.|
  Fly   246 TRLNSKLVIGRLTASELTFWQMQLFKEF---VKEQLRIRKFVQELQYLICVPVMADFIIFSVLIC 307

  Fly   285 TVAMHFLY------VADDHDHTAMIISIVFFSAVTLEVF-------VICYFGDRMRTQSEALCDA 336
                 ||:      |....|:..|.| .:|..|..|.::       |.|:         :.|..|
  Fly   308 -----FLFFALTVGVPSKMDYFFMFI-YLFVMAGILWIYHWHATLIVECH---------DELSLA 357

  Fly   337 FYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLL 393
            ::.|.|.......::.|:|.:...|||..:.| ..:.|:|.||..:.|..||.|.||
  Fly   358 YFSCGWYNFEMPLQKMLVFMMMHAQRPMKMRA-LLVDLNLRTFIDIGRGAYSYFNLL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 72/378 (19%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 60/315 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.