DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or49a

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:349 Identity:66/349 - (18%)
Similarity:132/349 - (37%) Gaps:82/349 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ANLKFANVYMVRKQL----HEIRSLLRLMDARARLVGDPEEISALRK-EVNIAQGTFRTFASIFV 142
            :.|||....:.||:|    |.::.|.            |.:....|| |||....:..|...::|
  Fly    86 SQLKFITFMINRKRLLQLSHRLKELY------------PHKEQNQRKYEVNKYYLSCSTRNVLYV 138

  Fly   143 FGTTL----------SCV-------------------RVVVRPDRELLYPAWFGVDWMHSTRNYV 178
            :...:          ||:                   |:....::.|.|...:.:|:.:|   ..
  Fly   139 YYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAYVIDFTYS---QF 200

  Fly   179 LINIYQLFGLIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEV 243
            ::|:    .|.......|.|..     :.:..|::..:...:|.                 ..|.
  Fly   201 IVNV----SLGTDLWMMCVSSQ-----ISMHLGYLANMLASIRP-----------------SPET 239

  Fly   244 YQELIECIRDLARVH----RLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMII 304
            .|:..:.:..:.:.|    ||::.:..|..:...:....::.:.|.:|   .|...:..:...|.
  Fly   240 EQQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMA---YYTVVEGFNWEGIS 301

  Fly   305 SIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAG 369
            .::.|::|..:.:|:...|..:...|..|..|.::..|.|...::|:|:|..:|:.|||..|.|.
  Fly   302 YMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISAR 366

  Fly   370 NYIALSLETFEQVMRFTYSVFTLL 393
            ..|.:||:||:.:|..||..|.::
  Fly   367 GVIIISLDTFKILMTITYRFFAVI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 63/341 (18%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 63/339 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465904
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.