DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or45b

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:400 Identity:84/400 - (21%)
Similarity:157/400 - (39%) Gaps:91/400 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LLYVVYSITVNLV----VTVLFPLSLLARLLFTTNMAGLCENLTITITDIVANLKFANVYMVRKQ 96
            ||::|::. |||.    ...:|..|.| |......|...|. |..:.|.:   .|...::..|::
  Fly    40 LLWLVFNF-VNLAHCCQAEFVFGWSHL-RTSPVDAMDAFCP-LACSFTTL---FKLGWMWWRRQE 98

  Fly    97 LHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTF-----RTFASIFVFGTTLSCVRVV--- 153
            :.::...:||      |:|:.|:....|::|  ||.::     |....:|..|:..:...|:   
  Fly    99 VADLMDRIRL------LIGEQEKREDSRRKV--AQRSYYLMVTRCGMLVFTLGSITTGAFVLRSL 155

  Fly   154 ----VRPDRELLYP--------------AWFGVDWMHSTRNYVLINIYQLFG------------- 187
                ||..:|..:.              .||.|.:::||.: ..:.:|...|             
  Fly   156 WEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPVFYLYSTWS-GQVTVYAFAGTDGFFFGFTLYMA 219

  Fly   188 LIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIR 252
            .::||::....|:..|         :|...||..:|.|                   |.|.:.:.
  Fly   220 FLLQALRYDIQDALKP---------IRDPSLRESKICC-------------------QRLADIVD 256

  Fly   253 DLARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVF 317
            ....:.::.:....:::.|....||.::.|..|..:..|..:..:    :|..:|:...|:..:|
  Fly   257 RHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYN----IIRYVVYTFTVSSAIF 317

  Fly   318 VICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQV 382
            :.||.|..|.|:|.:|.:|.|...|.....:.:|.:...:.|.|||..:.. .:.|.||..|..|
  Fly   318 LYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRV-PFFAPSLPVFTSV 381

  Fly   383 MRFTYSVFTL 392
            ::||.|:..|
  Fly   382 IKFTGSIVAL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 71/359 (20%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 71/363 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.