DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or45a

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster


Alignment Length:406 Identity:84/406 - (20%)
Similarity:149/406 - (36%) Gaps:82/406 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RVWELTG---------LMRPPGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFTTNMAGLCENLT 75
            |..|:.|         |..|.....|:..:.|....:||..|..||.|.||  |.|.|...:...
  Fly    11 RALEIVGFDPSTPQLSLKHPIWAGILILSLISHNWPMVVYALQDLSDLTRL--TDNFAVFMQGSQ 73

  Fly    76 ITITDIVANLKFANVYMVRKQLHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTFRTFASI 140
            .|...:|...|...:..:..:||::.....         ..|..:..:.:|..:.:...|:|.:.
  Fly    74 STFKFLVMMAKRRRIGSLIHRLHKLNQAAS---------ATPNHLEKIERENQLDRYVARSFRNA 129

  Fly   141 FVFGTTLSCVRVVVRPDRELLYPAWFGVD--------------WMHSTRN--YVLINIYQLFGLI 189
             .:|  :.|...:.    .:|...|..|:              |:...:.  |..|.::.:.|:.
  Fly   130 -AYG--VICASAIA----PMLLGLWGYVETGVFTPTTPMEFNFWLDERKPHFYWPIYVWGVLGVA 187

  Fly   190 VQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRDL 254
            ..|....|:|:    ....|| |...::.::..:....:..|.|.:    |...:........||
  Fly   188 AAAWLAIATDT----LFSWLT-HNVVIQFQLLELVLEEKDLNGGDS----RLTGFVSRHRIALDL 243

  Fly   255 ARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMI-ISIVFFSAVTLEVFV 318
            |:  .|..|...::.|    :::.|....|.:|..|    .....:|.: ....|..|:.:::..
  Fly   244 AK--ELSSIFGEIVFV----KYMLSYLQLCMLAFRF----SRSGWSAQVPFRATFLVAIIIQLSS 298

  Fly   319 ICYFGDRMRTQSEALCDAFY-DCNWIEQLPKFKRELLFTLARTQRPSLIY--------------- 367
            .||.|:.::.||.|:..|.| ..||.|..||.:|.....:.|.|||:.|:               
  Fly   299 YCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPAKIFGFMFVVDLPLLLWVI 363

  Fly   368 --AGNYIALSLETFEQ 381
              ||:::|: |.|||:
  Fly   364 RTAGSFLAM-LRTFER 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 68/351 (19%)
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 61/337 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.