DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or43a

DIOPT Version :10

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster


Alignment Length:67 Identity:15/67 - (22%)
Similarity:27/67 - (40%) Gaps:11/67 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PTELKKILAPYFAGFNQTTEVAD-----------AEGSMRFMHPQGVIVQKDKDSTFGKKALTDL 68
            |:|....|.......:.|:.|||           .|.::||...:..:||....:.:.:...||:
  Fly   777 PSESSLSLQDEGGAMHDTSTVADHLRWWDGVGYMNESTLRFEFNKFGMVQPLSAAEYERHCATDV 841

  Fly    69 FK 70
            :|
  Fly   842 YK 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 3/5 (60%)
Or43aNP_523647.2 7tm_6 56..364 CDD:251636
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.