DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or42b

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:380 Identity:93/380 - (24%)
Similarity:169/380 - (44%) Gaps:20/380 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YHWRVWELTGLMRP-PGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFTTNMAGLCENLT---IT 77
            |.:|..:..|.:.| .||...:|:.:::...:..|...||..|...:.........|.||   :.
  Fly    23 YLYRAMKFIGWLPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSPGEFLTSLQVC 87

  Fly    78 ITDIVANLKFANVYMVRKQLHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTFRTFASIFV 142
            |....:::|.|..|.:..:|.:.:::|..:|.|...:.:.|:|..:....|.|...| ||.....
  Fly    88 INAYGSSVKVAITYSMLWRLIKAKNILDQLDLRCTAMEEREKIHLVVARSNHAFLIF-TFVYCGY 151

  Fly   143 FGTTLSCVRVVVRPDRELLYPAWFGVDWMHSTRNYVLINIYQLFGLIVQAIQNCASDSYPPAFLC 207
            .|:|.....:..||..:|..|.   :||...|....:.:..:...:....:|:..|||||..:..
  Fly   152 AGSTYLSSVLSGRPPWQLYNPF---IDWHDGTLKLWVASTLEYMVMSGAVLQDQLSDSYPLIYTL 213

  Fly   208 LLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRDLARVHRLREIIQRVLSVPC 272
            :|..|:..|..|:||:  |::::    ..||   |.|:||::|:.|...:.|...||:.|:....
  Fly   214 ILRAHLDMLRERIRRL--RSDEN----LSEA---ESYEELVKCVMDHKLILRYCAIIKPVIQGTI 269

  Fly   273 MAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAF 337
            ..||:....|.....::..:.:   |....|.|.:|...:.|:.|..||..:.:....|:|..|.
  Fly   270 FTQFLLIGLVLGFTLINVFFFS---DIWTGIASFMFVITILLQTFPFCYTCNLIMEDCESLTHAI 331

  Fly   338 YDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTL 392
            :..||::...::|..||:.|...|:|.:..||....:|:.:...|.:|.:||.|:
  Fly   332 FQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 79/323 (24%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 79/320 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9588
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.