DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or9a

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:413 Identity:87/413 - (21%)
Similarity:163/413 - (39%) Gaps:51/413 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKQEDFKLNTHSAVYYHWRV--WELTGLMRPPGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFT 64
            ::::|..|.....||....:  |..|.....|.::       .:|:..:...:.|:.|.|. .:.
  Fly    10 QEEKDQSLRVQILVYRCMGIDLWSPTMANDRPWLT-------FVTMGPLFLFMVPMFLAAH-EYI 66

  Fly    65 TNMAGLCENLTITITDIVANLKFANVYMVRKQ----LHEIRSLLR-----LMDARARLVGDPEEI 120
            |.::.|.:.|..|...::..:||......||:    ::.||::|.     ..|||..:..:.:..
  Fly    67 TQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREIIEVENQSD 131

  Fly   121 SALRKEVNIAQGTFRTFASIFVF-GTTLSCVR---VVVRPDRELLYPAWFGVDWMHSTRNYVLIN 181
            ..|........|....||::..| |..||.:|   :.:......:||....| .|.....| |.|
  Fly   132 QMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQV-VMFYVPTY-LWN 194

  Fly   182 IYQLFGLIVQAIQNCASDSYPPAF---LCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEV 243
            :...:..:..|:  |. ||....|   :|.:....:...:.:..:|.:.|.....|..     .:
  Fly   195 VMASYSAVTMAL--CV-DSLLFFFTYNVCAIFKIAKHRMIHLPAVGGKEELEGLVQVL-----LL 251

  Fly   244 YQELIECIRDLARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVF 308
            :|:.::....:|  .:.|.:|        ..||..||...|.:...   |||...:...:..|.|
  Fly   252 HQKGLQIADHIA--DKYRPLI--------FLQFFLSALQICFIGFQ---VADLFPNPQSLYFIAF 303

  Fly   309 FSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIA 373
            ..::.:.:|:....|:.:::.|....:..|:.||.:..|..||.||....|.|||..: .|.:..
  Fly   304 VGSLLIALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQM-KGYFFE 367

  Fly   374 LSLETFEQVMRFTYSVFTLLLRA 396
            .|:.||..::|...| :.::||:
  Fly   368 ASMATFSTIVRSAVS-YIMMLRS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 72/336 (21%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 72/336 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.