DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or82a

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:382 Identity:86/382 - (22%)
Similarity:162/382 - (42%) Gaps:55/382 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VSSLLYVVYSITVNLVVTVLFPLSLLARLLFTTN-MAGLCENLTITITDIVANLKFANVYMVRKQ 96
            :|||::         |::..:|  |::.:.:..| |..:...|::..|:::..:|.:.....||.
  Fly    34 ISSLIF---------VISAQYP--LISYVAYNRNDMEKVTACLSVVFTNMLTVIKISTFLANRKD 87

  Fly    97 LHEIRSLLRLMDARARLVGDPEEISALRKEVN-IAQGTFRTFASIFVFGTTLSC----------- 149
            ..|:....|.|..::     ...|...|:.:: :|:.  ...||.......:||           
  Fly    88 FWEMIHRFRKMHEQS-----ASHIPRYREGLDYVAEA--NKLASFLGRAYCVSCGLTGLYFMLGP 145

  Fly   150 -VRVVV------RPDRELLYPAWFGVDWMHSTRNYVLINIYQLFGLIVQAIQNCASDSYPPAFLC 207
             |::.|      ..|:||..|..|..:.:.|. .|.:..:|.:...:|......|.|....:|..
  Fly   146 IVKIGVCRWHGTTCDKELPMPMKFPFNDLESP-GYEVCFLYTVLVTVVVVAYASAVDGLFISFAI 209

  Fly   208 LLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEV-YQELIECIRDLARVHRLREIIQRVLSVP 271
            .|..|.:.|:   |:|......|::..|....:..| |..|:     |:...:||.|....:   
  Fly   210 NLRAHFQTLQ---RQIENWEFPSSEPDTQIRLKSIVEYHVLL-----LSLSRKLRSIYTPTV--- 263

  Fly   272 CMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDA 336
             |.|||.: ::|..|.::.| |.:......:::...||.::.|::|:.||.|:.::.:|..:..|
  Fly   264 -MGQFVIT-SLQVGVIIYQL-VTNMDSVMDLLLYASFFGSIMLQLFIYCYGGEIIKAESLQVDTA 325

  Fly   337 FYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLL 393
            ....||....||.:..|...:.::|:..||.||.::| ||..|..:.|...|:.||:
  Fly   326 VRLSNWHLASPKTRTSLSLIILQSQKEVLIRAGFFVA-SLANFVGICRTALSLITLI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 77/341 (23%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 75/331 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.