DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or65c

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster


Alignment Length:446 Identity:82/446 - (18%)
Similarity:158/446 - (35%) Gaps:96/446 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DFKLNTHSAVYYHWRVWELTGLMRPPGVSSLLYVVYSITVNLVVTVLFPLS-------------- 56
            |.:.|.|..|.::...|:   ..|.|.:.|....||.....:....|:..|              
  Fly     2 DIRGNVHRFVKFYIDGWK---HFRDPTMESSYSAVYYWREQMKAMFLYTTSKERQMPYRSSWHTL 63

  Fly    57 --LLARLLFTTNMAGLCENLTITI---TDIVANLKFANVYMVRK---------QLHEIRSLLRLM 107
              :.|.:.|.|...|:.|:|...:   .||...:.|  .|:..|         :|.|:...|...
  Fly    64 VIIQATVCFLTMCYGVTESLGDKVQMGRDIAFIIGF--FYIAFKIYYFQWYGDELDEVVEALETF 126

  Fly   108 DARARL-VGDPEEISALRKEVNIAQGTFRTFASIFVFGTTLSCVRVVVRPDRELLYPAW------ 165
            ...|:. .|..:..:|.|....:|   |...:|..||    .|:.:::.    :..|.|      
  Fly   127 HPWAQKGPGAVDYRTAKRWYFTLA---FFLASSWLVF----LCIFILLL----ITSPLWVHQQIL 180

  Fly   166 -----FGVDW----MHSTRNYVLINIYQLFGLI-----VQAIQNCASDSYPPAFLCLLTGHMRAL 216
                 |...|    :|.. ::..|.::|.:.::     :..|:..:...|......:   .:..|
  Fly   181 PLHAAFPFQWHEKSIHPI-SHAFIYLFQTWNVMYFLTWLVCIEGLSVSIYVEITFAI---EVLCL 241

  Fly   217 ELRVRRIGCRTEKSNKGQTYEAWREEV------YQELIECIRDLARVHRLREIIQRVLSVPCMAQ 275
            |||.....|        ..||..|.|.      :|:::..:....:|.....|:|..::.     
  Fly   242 ELRHLHQRC--------HGYEQLRLETNRLVQFHQKIVHILDHTNKVFHGTLIMQMGVNF----- 293

  Fly   276 FVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDC 340
            |:.|.:|     :..:....|....|....::..:...|.::  .||||.:..:|..:.:|.|:.
  Fly   294 FLVSLSV-----LEAMEARKDPKVVAQFAVLMLLALGHLSMW--SYFGDLLSQKSLTISEAAYEA 351

  Fly   341 -NWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLLLR 395
             :.|:......|:|...:.|.|.|.::.|..:.:.:...:..::...|.:.|.||:
  Fly   352 YDPIKGSKDVYRDLCLIIRRGQEPLIMRASPFPSFNFINYSAILNQCYGILTFLLK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 63/360 (18%)
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 60/348 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.