DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or65a

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:430 Identity:80/430 - (18%)
Similarity:157/430 - (36%) Gaps:141/430 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WE-LTGLMRPPGVSSLLY-VVYSI--TVNL------VVTVLFPLSLLARLLFTTNMAGLCENLTI 76
            |: ...:.....::||.| :..||  .|||      ::|::|   :..||:|....||..:.:..
  Fly    66 WQYFVSIQLATALASLFYGISESIGDIVNLGRDLVFIITIIF---ICFRLVFFAQYAGELDVIID 127

  Fly    77 TITDIVA-NLKFANVYMVR--KQLHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTFRTFA 138
            .:.||.. ::|......|:  |:||.:..:..::                         |:.:|.
  Fly   128 ALEDIYHWSIKGPATKEVQETKRLHFLLFMALII-------------------------TWFSFL 167

  Fly   139 SIFVFGTTLSCVRVVVRPDRELLYPAW-------FGVDW---MHSTRN----YVLINIYQ----L 185
            .:|:.      :::..        |.|       |.|.|   :|....    |::|.:.|    |
  Fly   168 ILFML------IKIST--------PFWIESQTLPFHVSWPFQLHDPSKHPIAYIIIFVSQSTTML 218

  Fly   186 FGLI-VQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIE 249
            :.|| :..::|..     .:....||..:|.|.:.:|.:                     |||  
  Fly   219 YFLIWLGVVENMG-----VSLFFELTSALRVLCIELRNL---------------------QEL-- 255

  Fly   250 CIRDLARVH----RLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFS 310
            |:.|...::    |:.:..|:::.:......:.:.|....:.::||           ::|:..|.
  Fly   256 CLGDEDMLYRELCRMTKFHQQIILLTDRCNHIFNGAFIMQMLINFL-----------LVSLSLFE 309

  Fly   311 A--------VTLEVFVICY-----------FGDRMRTQSEALCDAF---YDCNWIEQLPKFKREL 353
            .        |.:|..:|..           |||....:||.:..|.   ||.|...:  ...|:.
  Fly   310 VLAAKKNPQVAVEYMIIMLMTLGHLSFWSKFGDMFSKESEQVALAVYEAYDPNVGSK--SIHRQF 372

  Fly   354 LFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLL 393
            .|.:.|.|:|.::.|..:...:||.:..:::..||:.|:|
  Fly   373 CFFIQRAQKPLIMKASPFPPFNLENYMFILKQCYSILTIL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 62/368 (17%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 57/340 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465246
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.