DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or69a

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:355 Identity:73/355 - (20%)
Similarity:142/355 - (40%) Gaps:42/355 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PLSLLARLLFTTNMAGLCENLTITITDIVANLK--FANVYMVRKQLHEIRSLLRLMDARARLVGD 116
            |::.||.|....:|.|.....|:.:..:: :||  |.|:      |:|...|.:|:..||..:..
  Fly    70 PIAYLAELASVASMLGFTIVGTLNLWKML-SLKTHFENL------LNEFEELFQLIKHRAYRIHH 127

  Fly   117 PEEISALRKEVNIAQGTFRTFASIFVFGTTLSCVRVVVRP----DRELLY----PAWFGVDWMHS 173
            .:|     |.....:.||....|..|:..:|. :.:::|.    .::|.|    ..|:  .|.  
  Fly   128 YQE-----KYTRHIRNTFIFHTSAVVYYNSLP-ILLMIREHFSNSQQLGYRIQSNTWY--PWQ-- 182

  Fly   174 TRNYVLINIYQLFGLIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEA 238
                |..:|...|..:...|.:|.::.....|:..|.... .::|.:...|.    :.:.:|.:|
  Fly   183 ----VQGSIPGFFAAVACQIFSCQTNMCVNMFIQFLINFF-GIQLEIHFDGL----ARQLETIDA 238

  Fly   239 WREEVYQELIECIRDLARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMI 303
            .......:|...|....::..|.:.:.|..:...:.....|....|.:|.. :.:.|.......:
  Fly   239 RNPHAKDQLKYLIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFS-MTMFDFGTSLKHL 302

  Fly   304 ISIVFFSAVTLEVFVICYFGDRM-RTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIY 367
            :.::.|  :|.. |.:|..|..: .|..:.|..|||: ||.|....::|.||..:.|..:|.:..
  Fly   303 LGLLLF--ITYN-FSMCRSGTHLILTSGKVLPAAFYN-NWYEGDLVYRRMLLILMMRATKPYMWK 363

  Fly   368 AGNYIALSLETFEQVMRFTYSVFTLLLRAK 397
            ......:|:.|:...::|:|.:||.:...|
  Fly   364 TYKLAPVSITTYMATLKFSYQMFTCVRSLK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 65/331 (20%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 68/339 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.