DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or46a

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_995793.1 Gene:Or46a / 2768728 FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster


Alignment Length:405 Identity:93/405 - (22%)
Similarity:164/405 - (40%) Gaps:54/405 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YYHWRVW--ELTGLMR-PPGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFTTNMAGLCENLTIT 77
            :|.::||  ::.|:.: |...:.......|:....::.:||.:.||.......|::.:.|.|.:.
  Fly     6 FYKYQVWYFQILGVWQLPTWAADHQRRFQSMRFGFILVILFIMLLLFSFEMLNNISQVREILKVF 70

  Fly    78 ITDIVANLKFA-NVYMVRKQLH---EIRSLLRLMDARARL---VGDPEEISALRKEVNIAQGTFR 135
                   ..|| .:..:.|.||   :.|.|..|:||....   |...:|:..|..: .:|....|
  Fly    71 -------FMFATEISCMAKLLHLKLKSRKLAGLVDAMLSPEFGVKSEQEMQMLELD-RVAVVRMR 127

  Fly   136 TFASIFVFGTTLSCVRVVVRPDRELLYPAWFG------------VDWMHSTRNYVLINIYQLFGL 188
            ....|...|.. |.:.:|...|.       ||            ..|:.....|:..:|.    |
  Fly   128 NSYGIMSLGAA-SLILIVPCFDN-------FGELPLAMLEVCSIEGWICYWSQYLFHSIC----L 180

  Fly   189 IVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRD 253
            :...:.|...||...:.||.|...::.|.||:.::|...|..:        .|::..||.||...
  Fly   181 LPTCVLNITYDSVAYSLLCFLKVQLQMLVLRLEKLGPVIEPQD--------NEKIAMELRECAAY 237

  Fly   254 LARVHRLREIIQRVLSVPCMAQFVCSAAVQCT--VAMHFLYVADDHDHTAMIISIVFFSAVTLEV 316
            ..|:.|.:::::..:..|...|.:||..|..:  ..|..:.:|:. |...|:.:.::...:..::
  Fly   238 YNRIVRFKDLVELFIKGPGSVQLMCSVLVLVSNLYDMSTMSIANG-DAIFMLKTCIYQLVMLWQI 301

  Fly   317 FVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGN-YIALSLETFE 380
            |:|||..:.:..||..||.:.|...|.......:|.:|..:.|...|.|:...| ..|.|||.|.
  Fly   302 FIICYASNEVTVQSSRLCHSIYSSQWTGWNRANRRIVLLMMQRFNSPMLLSTFNPTFAFSLEAFG 366

  Fly   381 QVMRFTYSVFTLLLR 395
            .::..:||.|.||.|
  Fly   367 SIVNCSYSYFALLKR 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 77/342 (23%)
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 76/339 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466070
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27053
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.