DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and LOC1272963

DIOPT Version :10

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_311894.2 Gene:LOC1272963 / 1272963 VectorBaseID:AGAMI1_014637 Length:77 Species:Anopheles gambiae


Alignment Length:31 Identity:11/31 - (35%)
Similarity:16/31 - (51%) Gaps:2/31 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 LPKFKRELLFTLARTQRPS--LIYAGNYIAL 374
            |||.:|...|...:....|  |:.||:|:.|
Mosquito     2 LPKLQRMASFVFLQHHIFSLGLVVAGSYVTL 32

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 11/31 (35%)
LOC1272963XP_311894.2 None

Return to query results.
Submit another query.