DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment kz and T07D4.5

DIOPT Version :9

Sequence 1:	NP_001284815.1	Gene:	kz / 31205	FlyBaseID:	FBgn0001330	Length:	1192	Species:	Drosophila melanogaster
Sequence 2:	NP_001122634.1	Gene:	T07D4.5 / 6418633	WormBaseID:	WBGene00045407	Length:	142	Species:	Caenorhabditis elegans

Alignment Length:	129	Identity:	31/129 - (24%)
Similarity:	41/129 - (31%)	Gaps:	52/129 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly   453 RTPDDYVAEAYRKTLKIHNKLPEGGILIFVTGQQEVNQLVRKLRRTFPYHHAPTKDVAKN----- 512
            :||.|:..|...||                   .|:..|..||      :||  |:...|
Worm    15 KTPHDHQKELRDKT-------------------SEIIYLSTKL------NHA--KETCVNLDNER 52

  Fly   513 ---GKVSEEEKEETIDDA----------ASTVEDPKELEFDMKRV--IRN-----IRKSKKKFL 556
               .:||.:.||:.||..          .|.......||.|.|.|  :|.     |:|....||
Worm    53 QKFREVSRKIKEKDIDPVWIYNGTCFLQTSQANSLNILEKDTKTVEEVRGQIQEVIKKDMDTFL 116

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
kz	NP_001284815.1	HrpA	237..1058	CDD:224557	31/129 (24%)
		DEXDc	279..418	CDD:238005
		P-loop_NTPase	369..>500	CDD:304359	10/46 (22%)
		HELICc	619..704	CDD:197757
		HA2	774..859	CDD:214852
		OB_NTP_bind	915..1039	CDD:285018
T07D4.5	NP_001122634.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1643
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900