DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kz and zcchc17

DIOPT Version :9

Sequence 1:NP_001284815.1 Gene:kz / 31205 FlyBaseID:FBgn0001330 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_956838.2 Gene:zcchc17 / 393516 ZFINID:ZDB-GENE-040325-2 Length:235 Species:Danio rerio


Alignment Length:221 Identity:48/221 - (21%)
Similarity:78/221 - (35%) Gaps:81/221 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VHNAKAR----QNPQTIVD----------NSAVK----KIQIDVDAVAGGNQVGYDEANALVLPS 51
            ||.::..    :||..|||          ...:|    |:...:.:|..|.....|..|.:....
Zfish    47 VHKSEMSACRVENPAEIVDVGEQVWIKVIGKEMKDDKVKLSFSMKSVNQGTGRDLDPNNVIAEQD 111

  Fly    52 EKRATKIKVDKVQHVKILSKKQRKHLQAIVDKKKKKEG-RAQLLGD------LAAVQIPEEELQQ 109
            |:|..:.:    .|     ..||..|:|:::...||.| |.....|      |....:||||.::
Zfish   112 ERRRRQFR----DH-----SGQRITLEAVLNTTCKKCGCRGHFAKDCFSSPGLQYSLLPEEEEEE 167

  Fly   110 YTSISQVQTVGLKRLPTLDEYLAKKKERQAQVLAEKSSASGLRVNAIKGSKRKLLVEEEEELQAK 174
            ..|....|:...||          |||::|:                        .|::::.:.|
Zfish   168 PLSTQITQSEPQKR----------KKEKKAK------------------------KEKKKKKERK 198

  Fly   175 RKNPNVISVEEDDEDSSSSDEDDEEA 200
            |:|             ||||..:|:|
Zfish   199 REN-------------SSSDSSNEDA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kzNP_001284815.1 HrpA 237..1058 CDD:224557
DEXDc 279..418 CDD:238005
P-loop_NTPase 369..>500 CDD:304359
HELICc 619..704 CDD:197757
HA2 774..859 CDD:214852
OB_NTP_bind 915..1039 CDD:285018
zcchc17NP_956838.2 S1_pNO40 16..89 CDD:240191 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.