DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kz and Y108F1.5

DIOPT Version :9

Sequence 1:NP_001284815.1 Gene:kz / 31205 FlyBaseID:FBgn0001330 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_001361911.1 Gene:Y108F1.5 / 353490 WormBaseID:WBGene00022433 Length:147 Species:Caenorhabditis elegans


Alignment Length:147 Identity:35/147 - (23%)
Similarity:61/147 - (41%) Gaps:25/147 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   771 LIVLGALEVAKTENTDLPPAVTRLGHVISRFPVAPRFGKMLALSHQQNLLPYTVCLVAALSVQEV 835
            |..|||::    |.:.|   .:.||..::.||:.|...|.|..|.:.......|.:||.:.:|:|
 Worm     8 LYALGAID----ETSQL---TSPLGLQMAEFPLPPMHSKCLLKSAEFGCFTEMVTIVAMMQIQDV 65

  Fly   836 LIETGVQRDE-DVAPGANRFHRKRQSWAASGNYQLLGDPMVLLRAVGAAEYAGSQGRLPEFCAAN 899
            .|....||.: ||.       ||:.:.....:..:|.   |..:.|       ..||..::|:.:
 Worm    66 FITPYRQRHQADVI-------RKKFAVEEGNHITMLN---VFTKFV-------ENGRSKKWCSDH 113

  Fly   900 GLRQKAMSEVRKLRVQL 916
            .:..:.:.....:|.||
 Worm   114 FVNYRGLMRADNVRSQL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kzNP_001284815.1 HrpA 237..1058 CDD:224557 35/147 (24%)
DEXDc 279..418 CDD:238005
P-loop_NTPase 369..>500 CDD:304359
HELICc 619..704 CDD:197757
HA2 774..859 CDD:214852 25/85 (29%)
OB_NTP_bind 915..1039 CDD:285018 2/2 (100%)
Y108F1.5NP_001361911.1 HrpA <1..>144 CDD:224557 35/147 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.