Protein Alignment kz and DHX36

DIOPT Version :10

• Sequence 1: NP_476591.1
• Gene: kz / 31205
• FlyBaseID: FBgn0001330
• Length: 1192
• Species: Drosophila melanogaster
• Sequence 2: NP_065916.2
• Gene: DHX36 / 170506
• HGNCID: 14410
• Length: 1008
• Species: Homo sapiens
• Alignment Length: 61
• Identity: 15/61 - (24%)
• Similarity: 29/61 - (47%)
• Gaps: 10/61 - (16%)

  Fly    67 ERDQECCEHG-CCPKDQHWMAGVYVLLAFVLLVFVVGTCLMICCYQRSKNRQRKEELEAAE 126
            |.::|..|.| .||.|:..:.|.:  |..:.....:|||       .:.|::.::.:.||:
Human  1160 EEEEESSEEGEYCPWDRELLQGQW--LQHLSKEEEMGTC-------EAGNKRLQQIITAAD 1211

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
kz	NP_476591.1	HrpA	260..>1071	CDD:441249
		DEXHc_DHX37	260..439	CDD:350740
DHX36	NP_065916.2	Necessary for nuclear and nucleolar caps localizations. /evidence=ECO:0000269|PubMed:18279852	1..200
		Required for the pre-miR-134 transport. /evidence=ECO:0000250|UniProtKB:D4A2Z8	1..104
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	1..58
		Required for recruitment to cytoplasmic stress granules. /evidence=ECO:0000269|PubMed:18854321	1..51
		Required for G4-DNA-and G4-RNA-binding. /evidence=ECO:0000269|PubMed:21149580, ECO:0000269|PubMed:21846770, ECO:0000269|PubMed:24151078	53..105
		DSM (DHX36-specific motif). /evidence=ECO:0000269|PubMed:20472641, ECO:0000269|PubMed:22238380, ECO:0000269|PubMed:24369427, ECO:0000269|PubMed:26195789, ECO:0000269|PubMed:26649896	53..75
		RecA-like domain 1. /evidence=ECO:0000250|UniProtKB:Q05B79	106..386
		DEXHc_DHX36	207..386	CDD:350739
		HrpA	215..>776	CDD:441249
		Necessary for interaction with single-stranded DNA at the 3'-end of the G4-DNA structure. /evidence=ECO:0000250|UniProtKB:Q05B79	265..317
		DEAH box. /evidence=ECO:0000255|PROSITE-ProRule:PRU00541	334..337
		RecA-like domain 2. /evidence=ECO:0000250|UniProtKB:Q05B79	387..628
		Necessary for interaction with single-stranded DNA at the 3'-end of the G4-DNA structure. /evidence=ECO:0000250|UniProtKB:Q05B79	498..557
		Nuclear localization signal. /evidence=ECO:0000303|PubMed:14731398	517..528
		WH domain. /evidence=ECO:0000250|UniProtKB:Q05B79	629..698
		Necessary for interaction with single-stranded DNA at the 3'-end of the G4-DNA structure. /evidence=ECO:0000250|UniProtKB:Q05B79	638..697
		OB_NTP_bind	831..917	CDD:400182
		OB-fold-like subdomains. /evidence=ECO:0000250|UniProtKB:Q05B79	841..905
		Necessary for interaction with single-stranded DNA at the 3'-end of the G4-DNA structure. /evidence=ECO:0000250|UniProtKB:Q05B79	849..860
		Necessary for interaction with single-stranded DNA at the 3'-end of the G4-DNA structure. /evidence=ECO:0000250|UniProtKB:Q05B79	870..900