DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and ZMYND15

DIOPT Version :9

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001254751.1 Gene:ZMYND15 / 84225 HGNCID:20997 Length:750 Species:Homo sapiens


Alignment Length:322 Identity:70/322 - (21%)
Similarity:102/322 - (31%) Gaps:90/322 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RPGGGGGDTTLAALSAHMAPCRDTTPEQLAQLIDVHLGDLRQEQPNWTISSSTVAGRGVFATRDI 75
            |..||.|.|            ....||:     |..|....:|.|..|    ...|....|.|:.
Human   128 REDGGAGST------------EKVEPEE-----DRELAPTSRESPQET----NPPGESEEAAREA 171

  Fly    76 AAGELIFQERAL--VTGPTARKGQLSSCICCHETLPQTGFLCRHRCTLPVCETCSDSEEHQA--- 135
            ..|:...:|..:  .|.|..||||.|.....|.:           |.|.|      ::||..   
Human   172 GGGKDGCREDRVENETRPQKRKGQRSEAAPLHVS-----------CLLLV------TDEHGTILG 219

  Fly   136 ------ECEHFRRWQPKDVDAEQEQVNPMSLRILTAVRVFHLG----KEQRHLV--DA-MQANAE 187
                  ..:....|     .:..:.:.|.:..:|.......:|    ::.|.|.  || :....|
Human   220 IDLLVDGAQGTASW-----GSGTKDLAPWAYALLCHSMACPMGSGDPRKPRQLTVGDARLHRELE 279

  Fly   188 RAYRREIIQAAQC-FRNF-PTTDRVFMDQLFRIVGVLNTNAFEA---PCRSGG-----HETLLRG 242
            ....|..::.|:. .|.: |.....|.....|...|.:.::|||   ||....     .|..||.
Human   280 SLVPRLGVKLAKTPMRTWGPRPGFTFASLRARTCHVCHRHSFEAKLTPCPQCSAVLYCGEACLRA 344

  Fly   243 LFPLTAIMNHECTPNASHYFENGRLAVVRAARDIPKGGEITT---TYTKILWGNLTRNIFLK 301
            .:       ..|..:.||.|...|||..     :.:.||:.|   |||    ..:|...|.|
Human   345 DW-------QRCPDDVSHRFWCPRLAAF-----MERAGELATLPFTYT----AEVTSETFNK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 28/116 (24%)
ZMYND15NP_001254751.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..199 24/91 (26%)
zf-MYND 313..359 CDD:280009 13/52 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 565..590
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148801
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.