DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and ASHR2

DIOPT Version :9

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_849991.1 Gene:ASHR2 / 816483 AraportID:AT2G19640 Length:398 Species:Arabidopsis thaliana


Alignment Length:386 Identity:71/386 - (18%)
Similarity:130/386 - (33%) Gaps:86/386 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QPNWTISSSTVAGRG--VFATRDIAAGELIFQERALV---TGPTARKGQLSSCICCHETLPQTGF 113
            :|...:..:.:.|||  :.|.:.:.||::|.:|..|:   ..|.........|..|...|..:..
plant     8 KPETLLRVAEIGGRGRSLVAAQSLRAGQVILRESPLLLYSAFPFLSSSVSPYCDHCFRLLASSAH 72

  Fly   114 LCRHRCTL-PVCETCSDSEEHQAECEHFRRWQPKDVDAEQEQVNPMSLR---ILTAVRVFHLGKE 174
            .....|:| ..|.....:......||..||.......|..:|.:...::   :|:|..:......
plant    73 QKCQSCSLVSFCSPNCFASHTPWLCESLRRLHQSSSSAFSDQPSDRQVQARFLLSAYNLAAASPS 137

  Fly   175 QRHLVDAMQA--------------NAERAYRREIIQAAQCFRNFPTTDRVFMDQLFRIVGVLNTN 225
            ...::.::|.              :|...:...::.:. | .:.|.:  :..|....::.....|
plant   138 DFQILLSLQGSGSSNGDPSCSAGDSAAAGFLHSLLSSV-C-PSLPVS--ISPDLTAALLSKDKVN 198

  Fly   226 AF--EAPCRSGGHETLLR--GLFPLTAIMNHECTPNASHY------FENGRLAVVRAARDIPKGG 280
            ||  ..||.....:..:|  |::|.|:..||:|.|||..:      .:.....::|...|:|:|.
plant   199 AFGLMEPCSVSNEKRSVRAYGIYPKTSFFNHDCLPNACRFDYVDSASDGNTDIIIRMIHDVPEGR 263

  Fly   281 EITTTYTKILWGNLTRNIFLKMTKHFACDCVRCH------------------------------- 314
            |:..:|..:.....:|...|.....|.|||.||.                               
plant   264 EVCLSYFPVNMNYSSRQKRLLEDYGFKCDCDRCKVEFSWSEGEEDENEIMEEMEDQDEQEEMEDS 328

  Fly   315 --DNTE----NGT----------YLSALFCREQGCRGLVIPVQTRTLQPD--WRCITCENV 357
              :|.|    ||.          :.....|.::.|.|.:.|:..:|....  ..|..|.:|
plant   329 VGENEEEVCGNGVDDESNFPHAYFFVRYMCEKENCFGTLAPLPPKTHDASRVLECNVCGSV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 24/113 (21%)
ASHR2NP_849991.1 SET <192..275 CDD:214614 21/82 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4168
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.