DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and SDG37

DIOPT Version :9

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_849969.2 Gene:SDG37 / 816300 AraportID:AT2G17900 Length:485 Species:Arabidopsis thaliana


Alignment Length:428 Identity:107/428 - (25%)
Similarity:173/428 - (40%) Gaps:100/428 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ISSSTVAGRGVFATRDIAAGELIFQERALVTGPTARKGQLSSCICCHETLPQTGFLCRHRCTLPV 123
            :|:....||.:|..||...||:|..::..:..|.....: |.|..|.:|           ..|..
plant    20 VSNLPQKGRSLFTARDFRPGEVILSQKPYICVPNNTSSE-SRCDGCFKT-----------NNLKK 72

  Fly   124 CETC------------SDSEEHQAECEHFRRWQPKDVDAEQEQVNPMSLRILTAVRVF---HLGK 173
            |..|            |:.:.|:.||:...|     ::.|:.:....::|::  ||::   :|..
plant    73 CSACQVVWYCGSSCQKSEWKLHRDECKALTR-----LEKEKRKFVTPTIRLM--VRLYIKRNLQN 130

  Fly   174 EQ---------RHLVDAMQANAERAYRREIIQAAQ------CFRNFPTTDRVFMDQLFRIVGVLN 223
            |:         ..||:|:.::......::::..||      ....||:.|   :.::.......:
plant   131 EKVLPITTTDNYSLVEALVSHMSEIDEKQMLLYAQMANLVNLILQFPSVD---LREIAENFSKFS 192

  Fly   224 TNAFEAPCRSGGHETLLR----GLFPLTAIMNHECTPNASHYFENGRLAVVRAARDIPKGGEITT 284
            .|| .:.|     ::.||    |||||.:|:||.|:|||...||. ::|||||..:|.|..|||.
plant   193 CNA-HSIC-----DSELRPQGIGLFPLVSIINHSCSPNAVLVFEE-QMAVVRAMDNISKDSEITI 250

  Fly   285 TYTKILWGNLTRNIFLKMTKHFACDCVRC------HDNTENGTYLSALFCREQGCRGLVIPVQTR 343
            :|.:.....|||...||....|.|.|.||      || .|....|....|..:.|.|.::     
plant   251 SYIETAGSTLTRQKSLKEQYLFHCQCARCSNFGKPHD-IEESAILEGYRCANEKCTGFLL----- 309

  Fly   344 TLQPDWRCITCENVFPHAKMAKYQDFA--LNTINNRI-NSCSVQDMIHFINELCPRFCPSSNYVL 405
             ..|:.:...|:.........:.:..|  |.|::.:. .|.|.:|....| ||         |..
plant   310 -RDPEEKGFVCQKCLLLRSKEEVKKLASDLKTVSEKAPTSPSAEDKQAAI-EL---------YKT 363

  Fly   406 IEAKLNVIWRMTRFDHEEYTPEEMGHMDRYREEVLAIL 443
            || ||.|     :..|....|     :.|.||::|.:|
plant   364 IE-KLQV-----KLYHSFSIP-----LMRTREKLLKML 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 35/113 (31%)
SDG37NP_849969.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.