powered by:
Protein Alignment SmydA-8 and Zmynd15
DIOPT Version :9
Sequence 1: | NP_001014717.1 |
Gene: | SmydA-8 / 31200 |
FlyBaseID: | FBgn0053548 |
Length: | 462 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001025100.1 |
Gene: | Zmynd15 / 574428 |
MGIID: | 3603821 |
Length: | 736 |
Species: | Mus musculus |
Alignment Length: | 65 |
Identity: | 21/65 - (32%) |
Similarity: | 26/65 - (40%) |
Gaps: | 6/65 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 377 RINSCSVQDMIHFINELCPRFCPSSNYVLI--EAKLNVIWRMTRFD--HEEYTPEEMGHMDRYRE 437
|..:|.|.....|..:|.| ||..:.||. ||.|...||....| |..:.|.....|:|..|
Mouse 303 RARTCHVCHKHSFEVKLTP--CPQCSAVLYCGEACLQADWRRCPDDVSHRFWCPRLSAFMERVGE 365
Fly 438 437
Mouse 366 365
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167838885 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG2084 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.