DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and smyd3

DIOPT Version :9

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001032477.1 Gene:smyd3 / 569507 ZFINID:ZDB-GENE-051120-138 Length:380 Species:Danio rerio


Alignment Length:329 Identity:76/329 - (23%)
Similarity:122/329 - (37%) Gaps:94/329 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GRGVFATRDIAAGELIF--QERALVTGPTARKGQLSSCICCHETLPQTGFLCRHRCTLPVCETCS 128
            |.|:.|.|:|..||:|:  :..|........|....||:...|:|.:    |....|...|....
Zfish    15 GNGLRALREIKPGEVIYSCEPFAFCVARDFLKTACQSCLKRGESLSR----CSQCKTARYCNVQC 75

  Fly   129 DSE---EHQAECEHFRRWQPKDVDAEQEQVNPMSLRILTAV-------------RVFHLGKEQRH 177
            ..:   :|:.||:..:..||:        :...|:|::..:             .::.:.:.|.|
Zfish    76 QKQAWPDHKRECKCLKHLQPR--------IPTDSVRLVARIIFKLLSQSESDQEELYSIAEHQSH 132

  Fly   178 LVDAMQANAERAYRREIIQAAQCFRNFPTTDRVFMDQ----LFRIVGVLN---------TNAFEA 229
            |.|..:...|.            .::..||.:|::.:    |.|:...|:         .|.|. 
Zfish   133 LADMSEEKTEG------------LKHLCTTLQVYLAEENCDLSRLPSGLDPVSLLARVTCNCFS- 184

  Fly   230 PCRSGGHETLLRGLFPLTAIMNHECTPNASHYFENGRLAVVRAARDIPKGGEITTTYTKIL---- 290
             ...|..:.:..||:|..:::||:|.||....||..|| .:||.|.|....|:|.:||.||    
Zfish   185 -ISDGELQDVGVGLYPSMSLLNHDCQPNCIMMFEGKRL-TLRAVRVIRSAEELTISYTDILAPSK 247

  Fly   291 ------WGNL----------------TRNIFLKMTKHFACD-CVRCHDNTENGTYLSALFCREQG 332
                  |..|                .|||::......|.| |:...|      |.:||   |.|
Zfish   248 DRRSQHWDELLKESQALLHRHSDVVPDRNIYMLRLLDLAMDACISLDD------YETAL---EYG 303

  Fly   333 CRGL 336
            .|.|
Zfish   304 NRAL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 32/126 (25%)
smyd3NP_001032477.1 zf-MYND 49..87 CDD:280009 8/41 (20%)
SET <201..239 CDD:279228 15/38 (39%)
TPR_12 276..351 CDD:290160 13/41 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582755
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.