DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and smyd1b

DIOPT Version :9

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001034725.1 Gene:smyd1b / 569027 ZFINID:ZDB-GENE-060522-1 Length:486 Species:Danio rerio


Alignment Length:288 Identity:72/288 - (25%)
Similarity:109/288 - (37%) Gaps:54/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GRGVFATRDIAAGELIFQER--ALVTGPTARKGQLSSCICCHETLPQTGFLCRHRCTLPVCE-TC 127
            |||:.||::..||:::|.|.  |.|...:.......||....|.|.:.| .||.   ...|: ||
Zfish    13 GRGLRATKEAWAGDVLFAEPPFASVVFDSQASSICHSCFRRQEKLQRCG-QCRF---AQYCDKTC 73

  Fly   128 SDS--EEHQAECEHFRRWQPKDVDAEQEQVNPMSLRILTAVRVFHLGKEQRHLVDAMQANAERAY 190
            ..:  |||:.||...:.:.           .|.|..:..|.|:.....:|..:|...|.......
Zfish    74 QRAGWEEHKLECAAIKTYG-----------KPPSENVRLAARILWRMDKQGSVVSDNQLTTLEDL 127

  Fly   191 RREIIQAAQ--------CFRNF---------PTTDRVFMDQLFRIVGVLNTNAFEAPCRSGGHET 238
            ...|...::        ...||         |.|    :|.:..|:||:|.|.|....:. |.:.
Zfish   128 EDHICDISEDDLKDFKVDIHNFLDYWPRNSKPHT----VDSVSHILGVINCNGFMVSDQR-GLQA 187

  Fly   239 LLRGLFPLTAIMNHECTPNASHYFENGRLAVV------------RAARDIPKGGEITTTYTKILW 291
            :..||||...::||:|.||.:....||..:.:            ||...|..|.|:|..|...|.
Zfish   188 VGVGLFPNLCLVNHDCWPNCTVILNNGNQSAIDTVFHSQKRIELRALGKISAGEEVTVAYVDYLN 252

  Fly   292 GNLTRNIFLKMTKHFACDCVRCHDNTEN 319
            .:..|...||....|.|.|..|.:..::
Zfish   253 VSADRQRLLKQQYFFDCTCKHCTEKIKD 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 32/132 (24%)
smyd1bNP_001034725.1 zf-MYND 47..85 CDD:280009 13/41 (32%)
SET <173..247 CDD:214614 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582763
Domainoid 1 1.000 54 1.000 Domainoid score I11197
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.