DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and Smyd3

DIOPT Version :9

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001020933.1 Gene:Smyd3 / 498295 RGDID:1562635 Length:428 Species:Rattus norvegicus


Alignment Length:297 Identity:74/297 - (24%)
Similarity:118/297 - (39%) Gaps:72/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GRGVFATRDIAAGELIFQERALVTGPTARKGQ----LSSCICCHETLPQTGFLCRHRCTLPVCET 126
            |.|:.|...:..|||:|:...|..  |..||.    ...|:...|.|.:.. .||      :.:.
  Rat    15 GNGLRAVAPLRPGELLFRSDPLAY--TVSKGSRGVVCDRCLLGKEKLMRCS-QCR------IAKY 70

  Fly   127 CSDS------EEHQAECEHFRRWQPKDVDAEQEQVNPMSLRILTAVRVFHLGKEQRHLVDAMQAN 185
            ||..      .:|:.||:..:..:|:        ..|.|:|:|..|.|        .|:|...:.
  Rat    71 CSAKCQKKAWPDHKRECKCLKSCKPR--------YPPDSVRLLGRVVV--------KLMDGKPSE 119

  Fly   186 AERAY----------------RREIIQAAQCFRNF------------PTTDRVFMDQLFRIVGVL 222
            :|:.|                :..:.|.|..|::|            |:.|      ||.....:
  Rat   120 SEKLYSFYDLESNISKLTEDKKEGLRQLAMTFQHFMREEIQDASQLPPSFD------LFEAFAKV 178

  Fly   223 NTNAFEAPCRSGGHETLLRGLFPLTAIMNHECTPNASHYFENGRLAVVRAARDIPKGGEITTTYT 287
            ..|:|.. |.:...|..: ||:|..:::||.|.||.|..| ||...::||.|:|..|.|:|..|.
  Rat   179 ICNSFTI-CNAEMQEVGV-GLYPSMSLLNHSCDPNCSIVF-NGPHLLLRAVREIEAGEELTICYL 240

  Fly   288 KILWGNLTRNIFLKMTKHFACDCVRCHDNTENGTYLS 324
            .:|..:..|...|:....|.|||:||....::...|:
  Rat   241 DMLMTSEERRKQLRDQYCFECDCIRCQTQDKDADMLT 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 34/131 (26%)
Smyd3NP_001020933.1 zf-MYND 49..87 CDD:280009 8/44 (18%)
SET <201..239 CDD:279228 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.