DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and Smyd5

DIOPT Version :9

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster


Alignment Length:369 Identity:74/369 - (20%)
Similarity:123/369 - (33%) Gaps:119/369 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 NWTISSSTVAGRGVFATRDIAAGELIFQERALVTGPTARKGQLSSCICCH-----ETL------- 108
            |:.|......||.:.||::.|..|:||:|...|:...:.........|.|     ||:       
  Fly     3 NFEIRELPGKGRAMIATKNFAKDEVIFEEEPFVSRQFSWNVAYGYAACDHCMRPLETVLENVRRL 67

  Fly   109 ---PQTGF-LCRH--------------RCTLPVC-ETC---SDSEEHQAECE---HFRRWQPKDV 148
               |:... |.:|              ||.:..| |.|   :....|:..|.   |.....|.:|
  Fly    68 ASDPKVEVPLLQHDPTAQWVAQFTQCPRCKVRYCSEDCLMEAQKRYHRVACMGAFHSDDTHPINV 132

  Fly   149 DAE---QEQVNPMSLRILTAVRVFHLGK---------EQRHLVDAMQANAERA---------YRR 192
            ..|   :....|.:..|:..||:..|.:         ||.....::..|.|:.         :.:
  Fly   133 LNETWKKMHYPPETGSIMLIVRLMALYQQSTKKEEFLEQLQSFQSLIVNREQKIYHKMLGENFEQ 197

  Fly   193 EIIQAAQCFRNFPTTDR--VFM--DQLFRIVGVLNTNA---------------FEAPCRSGGHE- 237
            ::.|....|.|..|.:.  :|.  |....::.:|.||:               .:.|......| 
  Fly   198 QMEQLYLAFCNAFTGEEFSIFKTPDAFKTLMAILGTNSQGIATSVLSQWVAKVSDLPLTDSEKEQ 262

  Fly   238 --TLLRGLFP-------------------LTAIMNHECTPNASHYFE-NGRLAVVRAARDIPKGG 280
              |::.||:.                   |.:.:||.|.|||...|. :..:.|::|...|.:|.
  Fly   263 LDTVIDGLYAKVGEFAGEFLNNEGSGLYLLQSKINHSCVPNACSTFPYSNDIVVLKALAPIQQGE 327

  Fly   281 EITTTYTKILWGNLTRNIFLKMTKH-----------FACDCVRC 313
            ||..:|..        ...|:.::|           |.|.|.:|
  Fly   328 EICISYLD--------ECMLERSRHSRHKVLRENYVFICQCPKC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 29/154 (19%)
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 6/30 (20%)
SET <296..333 CDD:279228 13/36 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452044
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.