DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and CG18213

DIOPT Version :9

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_650589.2 Gene:CG18213 / 42055 FlyBaseID:FBgn0038470 Length:879 Species:Drosophila melanogaster


Alignment Length:211 Identity:51/211 - (24%)
Similarity:84/211 - (39%) Gaps:46/211 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GVFATRDIAAGELIFQERALVTGPTARKGQLSSCICC--HETLPQTGFLCRHR--CTLPVCETC- 127
            ||||:.|:..||::..|..:....:|   ...:|..|  |:....|...||:|  |:    ::| 
  Fly   241 GVFASCDVPKGEIVLVENPVYFQFSA---PFLNCELCGVHQQQLYTCDNCRYRSYCS----KSCM 298

  Fly   128 -SDSEEHQAECEHFRRWQPKDVDAEQ---------EQVNP------MSLRILTAVR------VFH 170
             ||:|.||.||..::......::|..         |.:.|      |...||:..|      :.|
  Fly   299 KSDAEVHQYECYGYKIGLIPMLEANMLFRLFCEAGEYILPAIVDYAMDGGILSNPRDAWTFILEH 363

  Fly   171 LGKEQR--HLVDAMQANA------ERAYRREIIQAAQCFRNFPTTDRVFMDQLFRIVGVLNTNAF 227
            ..:|::  :||..:.|.|      .|....||:..|.....|...|....::.|.::.::.|:..
  Fly   364 AQEEEKTYNLVGELLATAPDYNLLTREKYTEIVTTAFRLSVFIYNDTRLAEKYFYLLALVKTDLI 428

  Fly   228 EAPC----RSGGHETL 239
            ....    |.|||..|
  Fly   429 TVMAAILLRLGGHVLL 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 12/55 (22%)
CG18213NP_650589.2 zf-MYND 271..309 CDD:280009 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473062
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.