DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and SmydA-2

DIOPT Version :9

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster


Alignment Length:424 Identity:113/424 - (26%)
Similarity:187/424 - (44%) Gaps:51/424 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RQEQPNWTISSSTVAGRGVFATRDIAAGELIFQERALVTGPTARKGQLSSCICCHETL-----PQ 110
            |.|...:.|:::.|.||.:.|||||..||.|.:|..||.||......|  |:.||..|     |:
  Fly    43 RSECQCFEIATNEVLGRHLRATRDIKIGEQILKEAPLVLGPKVASAPL--CLGCHRNLLAPGKPR 105

  Fly   111 TGFLCRHRCTLPVC-ETCSDSEEHQAECEHF--RRWQPK--DVDAEQEQVNPMSLRILTAVRVFH 170
            ..:.....|:.|:| :.|.||..|:|||:..  ..:|.|  .|..|:|: ...:..::..:|..|
  Fly   106 GNYHKCSSCSWPLCGKECEDSVHHKAECQLMSGSNFQSKINYVPGEEER-KESAYCVIMLLRCMH 169

  Fly   171 LGKE-----------QRHLVDAMQANAERAYRREI---IQAAQCFRNFPTTDRVFMDQLFRIVGV 221
            |..:           :.||.:.::....:..|..:   |:.....:::|..|      :.||..:
  Fly   170 LKDKDPDAFLKLYNLEDHLKERLETPLYQVLRANLITFIKTVLGMKDWPEMD------ILRIAAI 228

  Fly   222 LNTNAFEAPCRSGGHETLLRGLFPLTAIMNHECTPNASHYFENGRLAVVRAARDIPKGGEITTTY 286
            |:||.||.  |.......:|.|:|..|:::|:|.||..|.|::....|..|.|.|.||..::.:|
  Fly   229 LDTNTFEV--RQPRERRKIRALYPGAAMISHDCVPNMRHRFDDDMNIVFLAKRKIAKGEILSISY 291

  Fly   287 TKILWGNLTRNIFLKMTKHFACDCVRCHDNTENGTYLSALFCREQGCR-GLVIPVQTRTLQPDWR 350
            |:.|...:.|.:.|:..|.|.|.|.||.|..|.|::..|..|.:  |: |.:|.:........|:
  Fly   292 TQPLRSTIQRRVHLRQAKCFDCSCARCQDPEELGSFAGAQTCLK--CKAGKIISLNPLLNSAPWK 354

  Fly   351 CITCENVFPHAKMAKYQDFALNTINNRINSCSVQDMIHFINELCPRFCPSSNYVLIEAKLNVIWR 415
            |..| |....||.....|..|......::..:...:..||.........::.::| :||    :.
  Fly   355 CQLC-NFKRSAKDVVTSDAELQQELESLDKTTPVALEEFIYRHRADLHETNTHIL-QAK----YA 413

  Fly   416 MTR-------FDHEEYTPEEMGHMDRYREEVLAI 442
            :|:       |..||.:.|.:....:..||:|.:
  Fly   414 LTQLYGSAPGFAMEELSGESLNRKLQLCEELLKL 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 31/106 (29%)
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 1/2 (50%)
SET <246..291 CDD:214614 16/44 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11197
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46455
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.