DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and SmydA-1

DIOPT Version :9

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster


Alignment Length:462 Identity:108/462 - (23%)
Similarity:189/462 - (40%) Gaps:59/462 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CRDTTPEQLAQLIDVHLGDLRQEQPNW----------TISSSTVAGRGVFATRDIAAGELIFQER 85
            |.:.|..:.:....|....::.::.:|          .|:.:...||.:.|||.|...|::.:|.
  Fly     7 CEEPTKNKCSNCNQVSYCSVQHQKQDWKVHKPSCHPFKIAHNEQLGRHLVATRTIKPYEIVLKEA 71

  Fly    86 ALVTGPTARKGQLSSCIC--CHETLPQTGFLCRHRCTLPVC-ETCSDSEEHQAECEHFR-RWQPK 146
            .||.||    .|:|:.:|  |...:.....:...:|..|:| ..|...:||:|||...: |.|..
  Fly    72 PLVRGP----AQISAPVCLGCLNGIEAEDHIECEQCGWPLCGPECKSLDEHKAECGLTKDRGQKV 132

  Fly   147 DVDAEQEQVNPMSL-RILTAVRVFHLGKEQRHLVDAMQ--------ANAERAYRREIIQAAQCFR 202
            :|   ||...|..| ..|:.||...:|:.........|        ......::.:::...|...
  Fly   133 NV---QEFGGPHPLYTCLSTVRCLLIGETSTEKASKFQDLESLESTRRGSNQWKADLVSIGQFIP 194

  Fly   203 NFPTTDRVFMDQLFRIVGVLNTNAFEAPCRSGGHETLLRGLFPLTAIMNHECTPNASHYFENGRL 267
            .|..|.:...:::.:.||.|..|..|.|.....|.    .:|...:...:.|.||.:..|.....
  Fly   195 KFFKTQKFTEEEIMKAVGALQINGHEVPTTDPSHV----AVFYTASFTENSCLPNLAKSFNKNGH 255

  Fly   268 AVVRAARDIPKGGEITTTYTKILWGNLTRNIFLKMTKHFACDCVRCHDNTENGTYLSALFCREQG 332
            .::.|.|:|.|...::..|:..:||...|...|..||.|.|.|.||.|.||..|..||:.|.::.
  Fly   256 CILWAPREIKKNAHLSICYSDAMWGTADRQRHLMQTKLFKCACERCVDVTELDTNYSAIKCEDRQ 320

  Fly   333 CRGLVIPVQTRTLQPDWRCITCENVFPHAKMAK-YQDFALNTINNRINSCS--VQDMIHFINELC 394
            |.||::|.:.......|||..|     |.::.| |.:..|......|.|..  .::.:.::... 
  Fly   321 CGGLMLPTKADEWNGSWRCREC-----HKQVQKHYVERILERAGKDIQSMEKIAENGLKYLKHY- 379

  Fly   395 PRFCPSSNYVLIEAKLNVIWRMTRFDHEE--YTPEEMGHMDR------YREEVLAILHKLGAGEC 451
            .::.|..::.:.|.|:.::..:.: |.:|  ..|:     ||      :..|::.:..||  ..|
  Fly   380 EKWLPPQHFHMSEIKILLVQLLAK-DQKELMVIPD-----DRLLLKLNFARELVELYEKL--TPC 436

  Fly   452 TLKKLIT 458
            .::.|.|
  Fly   437 EVRTLGT 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 21/103 (20%)
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009 4/32 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46455
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.