DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and LOC3291278

DIOPT Version :10

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:XP_061513155.1 Gene:LOC3291278 / 3291278 VectorBaseID:AGAMI1_001906 Length:386 Species:Anopheles gambiae


Alignment Length:87 Identity:20/87 - (22%)
Similarity:36/87 - (41%) Gaps:25/87 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 QTGFLCRH--RCTLPVCETCSDSEEHQAECEHFRRWQPKDVDAEQEQVNPMSLRILTAVRVFHLG 172
            |..:|..|  .|.|..|.|.:|::          |.:.:.||           :|:..||...: 
Mosquito    22 QIKYLAEHALSCCLASCTTSADAQ----------RVRERFVD-----------QIIILVRSGGI- 64

  Fly   173 KEQRHLVDAMQAN-AERAYRRE 193
            ::|.:|...::.: |..|||.:
Mosquito    65 RDQLNLAPDVKGHVAALAYRAQ 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET 58..>88 CDD:394802
SET_SMYD <224..313 CDD:380997
LOC3291278XP_061513155.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.