DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and SmydA-4

DIOPT Version :9

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_572675.1 Gene:SmydA-4 / 32034 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster


Alignment Length:445 Identity:114/445 - (25%)
Similarity:192/445 - (43%) Gaps:57/445 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QEQPNWTISSSTVAGRGVFATRDIAAGELIFQERALVTGPTARKGQLSSCICCHE--TLPQTGFL 114
            :|.| :.:..|.:.||.:.|.|.:.|||.:.:|..|..||......:  |:.|:.  :|....:.
  Fly    45 KELP-YRVEHSDIYGRYLVANRQLEAGETLIREEPLAIGPCVSGDPV--CLGCYHPVSLKADQYR 106

  Fly   115 CRHRCTLPVC-ETCSDSEEH----QAECEHFRRWQPKDVDAEQEQVNPMSLR----ILTAVRVFH 170
            | ..|..|:| .||:..:..    :.||:.:...:....:...|:..|..:|    ::..||:..
  Fly   107 C-PGCAWPLCGSTCAGLKHRHGHTETECQLYAERRAVAGELLTERAGPAEVRDLYELVMIVRILL 170

  Fly   171 LGK---EQRHLVDAMQANAE---------RAYRREIIQAAQCFRNFPTTDRVFMDQLFRIVGVLN 223
            |.:   ||..|:..|:::.|         |.|..:::|..:........:   .:|:..:.|:|:
  Fly   171 LRQHDPEQFALIARMESHTEERRQNAVLWRHYEEKVVQRLRVTWQLEDLE---AEQVHEVCGILD 232

  Fly   224 TNAFEAPCRSGGHETLLRGLFPLTAIMNHECTPNASHYFENGRLAV-VRAARDIPKGGEITTTYT 287
            .|.||.    |.:....|.|:|...::.|:||||.:|..:.....: :|.:|.:.:...:|.:|.
  Fly   233 VNCFEI----GQNGAKARTLYPSAFLLAHDCTPNTAHTDDPSSFEILLRTSRRVREREALTLSYA 293

  Fly   288 KILWGNLTRNIFLKMTKHFACDCVRCHDNTENGTYLSALFCREQGCR-GLVIPVQTRTLQPDWRC 351
            ..|.|.|.|..|:...|.|.|.|.||.|..|.||..|||.|..  || |.|..|.......||.|
  Fly   294 YTLQGTLKRRAFMHEGKLFWCCCRRCSDPRELGTDCSALVCAT--CRTGSVRAVDPLQQTGDWAC 356

  Fly   352 ITCENVFPHAKMAKYQDFALNTINNRINSCSVQD-------MIHFINELCPRFCPSSNYVLIEAK 409
            ..|    .|...|...:..|:.|||.:....|.|       ::.:.:.|.|     ::|:|:.||
  Fly   357 DRC----AHKMGATEVERQLDRINNDLEDIDVHDIPGLENFLLRYRDVLRP-----NHYLLLSAK 412

  Fly   410 LN---VIWRMTRFDHEEYTPEEMGHMDRYREEVLAILHKLGAGECTLKKLITGEI 461
            .:   :..|...:...:.:||::...:.|..|.|.|:..|..|...|:.||..|:
  Fly   413 YSLCQIYGRTEGYLLPQMSPEDIARKESYCREFLEIVDVLDPGLTRLRGLIMYEL 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 23/104 (22%)
SmydA-4NP_572675.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11197
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46455
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.