DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and set6

DIOPT Version :9

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_596514.1 Gene:set6 / 2541370 PomBaseID:SPBP8B7.07c Length:483 Species:Schizosaccharomyces pombe


Alignment Length:365 Identity:79/365 - (21%)
Similarity:145/365 - (39%) Gaps:75/365 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GRGVFATRDIAAGELIFQER----ALVTGPTARKGQLSSCICCHETLPQTGFLCRHRC-TLPVCE 125
            |:|..||.:|..|::|.::|    :|.:....|     :|..|.|...:|     .|| ...:..
pombe    15 GKGTVATDNIPIGKIIIRKRVDILSLDSANLTR-----TCSTCTEEKVKT-----QRCAACKIIH 69

  Fly   126 TCS------DSEEHQAECEHFRRWQPKDVDAEQEQVNPMSLRILTAVRVFHLGKEQRHLVDAM-- 182
            .||      |...|:.||:..:.       ::|..:.|...|:|  :|::.|.::...:::.|  
pombe    70 YCSKGCQKADWPFHKLECKALQA-------SKQNGILPSVCRLL--IRLYLLWQKNPAIIEPMEG 125

  Fly   183 -----QANAERAYRREIIQAAQCFRNFPTTDRVFMDQLFR------IVGVLN--TNAFEAPCRSG 234
                 ||.:......|:|.:|.....     :::..:||:      .|..:|  |::|       
pombe   126 HQNEFQAVSSSWSDAELIASAASHYT-----QIYQAELFQKLFCRLAVNAMNLVTSSF------- 178

  Fly   235 GHETLLRGLFPLTAIMNHECTPNASHYFENGRLAVVRAARDIPKGGEITTTYTKILWGNLTRNIF 299
              ::|...|..:...:||.|.||....|: |.:..:.:.|||.|..::..:|..|......|...
pombe   179 --DSLGMCLDTILCRLNHSCDPNCQIIFD-GAIVQLVSKRDIKKDEQLFISYIDIRLPKSIRQKQ 240

  Fly   300 LKMTKHFACDCVRC-HDNTENGTYLSALFCREQGCRGLVIPVQTRTLQPD-WRCITCENVFP--- 359
            |.....|:|.|.|| :|:|...|..|....|.:..:.|   ::...:..| |.|...:..||   
pombe   241 LLKKYFFSCYCPRCENDHTTKETDGSKWMGRLRNSKSL---MKNLAMARDLWSCGWKQTAFPWSN 302

  Fly   360 ---HAKMAKYQDFALN----TINNRINSCSVQDMIHFINE 392
               |.|:....:...|    .:..:.::....|.:|.::|
pombe   303 LLHHIKLGMLDESNFNGAFAALYLKSSADEFLDALHVVDE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 24/111 (22%)
set6NP_596514.1 SET 5..483 CDD:225491 79/365 (22%)
zf-MYND 49..87 CDD:280009 10/42 (24%)
SET <142..227 CDD:279228 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.