DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-8 and set-3

DIOPT Version :9

Sequence 1:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_499143.1 Gene:set-3 / 182356 WormBaseID:WBGene00007403 Length:465 Species:Caenorhabditis elegans


Alignment Length:300 Identity:64/300 - (21%)
Similarity:104/300 - (34%) Gaps:71/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TISSSTVAGRGVFATRDIAAGELIFQERALVTGPTARKGQLSSCICCHETLPQTGFLC---RHRC 119
            |:......||.|.|..||..|.::..|    ||.|....            ||..:.|   ....
 Worm    21 TVKWDKKRGRFVEAIEDIPIGTVVCVE----TGITVNVD------------PQNCYRCLKITENA 69

  Fly   120 TLPVCETCSD-SEEHQAECEHFRR-------------WQPKDV-------DAEQEQVNPMSLRIL 163
            :...|:.|.: .|..:..|..|..             :...|:       |.|.....|.:|...
 Worm    70 SFAYCKNCEEFYEPDEIACGEFDELGIFKLAAHLVFSYPFADIASLVQSSDPEPPSCAPKALSTQ 134

  Fly   164 TAVRVFHLGKEQRHLVDAMQANAERAYRREIIQAAQCFRNFPTTDRVFMDQLF----RIVG---- 220
            ....:|.| .....:.:|.:|.|.:...:.|:::.:...|:...|::.....|    ||:.    
 Worm   135 DIEAIFQL-TPFPEIGEAFKAPAIQNAIKRIVESLETDENWGRLDQISRTMTFTKALRIMAERSA 198

  Fly   221 -----VLNTNAFEAPCRSGGHETLLRGLFPLTAIMNHECTPNASHYF-ENGRLAV---VRAARDI 276
                 :.:....|:   ...:..:..||||:::|.||.||||.|.:| .|..:.|   |||..::
 Worm   199 KNAHTIYSIEQIES---QEDNLPMATGLFPISSIFNHSCTPNISGFFVRNTFIFVSQGVRAREEL 260

  Fly   277 PKGGEIT---TTYTKILWGNLTRNIFLKMTKHFACDCVRC 313
            .....:|   .|:.:       |..||.....|.|.|..|
 Worm   261 LDSYGVTYHQHTFEQ-------RTNFLASVSGFICHCESC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 27/123 (22%)
set-3NP_499143.1 SET <220..271 CDD:214614 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.