DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mct1 and F10G7.5

DIOPT Version :9

Sequence 1:NP_001284810.1 Gene:Mct1 / 31198 FlyBaseID:FBgn0023549 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001359987.1 Gene:F10G7.5 / 173806 WormBaseID:WBGene00017369 Length:471 Species:Caenorhabditis elegans


Alignment Length:171 Identity:42/171 - (24%)
Similarity:75/171 - (43%) Gaps:12/171 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PDGGWGWVVVFGSFMIHIVTDGMTYSFGIFYNEFLDYF------NEGKGYTAWIASIMVGVTFSS 87
            |.|...|.|:.|..|. :||.|:.|:.|......:.||      :...|...|:.:::.|:..  
 Worm    26 PRGARPWAVLVGGVMC-MVTFGIVYTCGNLLPYLVSYFRWKMYPDMRTGQLIWLQTLLSGLPM-- 87

  Fly    88 GPISSSFVNR-YGCRAVTIAGSILAASCIIVSMFA--QNVLTLIITIGFGTGLGFGLIYLPAIVS 149
            |.:....|.| :|.||..:.|||:....:..:.::  .:....::|:|....:|..:.|...:.:
 Worm    88 GMVIGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIASVGSSIAYSSILPT 152

  Fly   150 VTQYFEAKRSLATGIAVCGSGFGTFVFAPLTEFLIGNYGWR 190
            ..::|.....||.||.:.|.|.|.|:.:||....|....:|
 Worm   153 AQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mct1NP_001284810.1 MFS 35..>213 CDD:119392 40/165 (24%)
MFS <426..604 CDD:119392
F10G7.5NP_001359987.1 2A0111 30..439 CDD:273323 40/167 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.