DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pn and PRUNE2

DIOPT Version :9

Sequence 1:NP_476684.1 Gene:pn / 31194 FlyBaseID:FBgn0003116 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_006717045.1 Gene:PRUNE2 / 158471 HGNCID:25209 Length:3104 Species:Homo sapiens


Alignment Length:404 Identity:93/404 - (23%)
Similarity:169/404 - (41%) Gaps:84/404 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLAQARGTLGRHLAEASPVAWAAAPDVSGR--KLHLVMGNESCDLDSAVSAVTLAFVYAQRHREH 68
            ||.:|:..|.|                |.|  |:|:|:|.:||||||.:|..|.|:..       
Human     4 FLQRAKSKLNR----------------SKRLEKVHVVIGPKSCDLDSLISTFTYAYFL------- 45

  Fly    69 DYV--------PILNIPRRDYPLKTEVGHLFVKCGIAEPVLLFRDDIPREVVQD---VNVILVDH 122
            |.|        |:|||||.::...||...:..:..|:|...:|||:|....:.|   :::.||..
Human    46 DKVSPPGVLCLPVLNIPRTEFNYFTETRFILEELNISESFHIFRDEINLHQLNDEGKLSITLVGS 110

  Fly   123 HV-----SPLAPNVTEILDHRPLEDSSPSFKQLPTLCQLDIDASV---GSCATLVAQRYLAEDQP 179
            .|     ..|...|.::::  |:|.|               ||:|   .|.::||.:..|.|...
Human   111 SVLASEDKTLESAVVKVIN--PVEQS---------------DANVEFRESSSSLVLKEILQEAPE 158

  Fly   180 RST-SVAQLLHATIVLDTINFAPAAKRYGPKDEAMVQKLESELNRKDAQRSSLFDELVAARADIS 243
            ..| .:|..|..:|:...:..  .:::...|.|.::..||.:.... ..|..:.:.|...:....
Human   159 LITEQLAHRLRGSILFKWMTM--ESEKISEKQEEILSILEEKFPNL-PPREDIINVLQETQFSAQ 220

  Fly   244 KLTLTEVLRKDMKVLQTDRQVVPLAGMPILVRDFVEKSGAEKAVR----EFGVESNLLVILGMYV 304
            .|::.:.:.||:|.|......|.::.:.:.:.:.:..|.....::    :||.:  :|::...|:
Human   221 GLSIEQTMLKDLKELSDGEIKVAISTVSMNLENCLFHSNITSDLKAFTDKFGFD--VLILFSSYL 283

  Fly   305 SPADGQVQRDLALISLSGQGQFVQRVQQALMESNDPKLELRPHEVDTRFMGGC----FLRQHNVQ 365
            | .:.|.:|.:|:  .|...:...::...|.|..:|.|||.|      |..||    ..:|.:..
Human   284 S-EEQQPRRQIAV--YSENMELCSQICCELEECQNPCLELEP------FDCGCDEILVYQQEDPS 339

  Fly   366 ATRKHILPIVKRAL 379
            .|...::.:||..:
Human   340 VTCDQVVLVVKEVI 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnNP_476684.1 PPX1 39..379 CDD:224148 84/367 (23%)
DHHA2 235..377 CDD:280923 30/149 (20%)
PRUNE2XP_006717045.1 PPX1 24..278 CDD:224148 64/282 (23%)
DHHA2 221..315 CDD:280923 18/98 (18%)
BNIP2 2799..2909 CDD:289278
CRAL_TRIO_2 2921..3042 CDD:290435
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1227
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545660at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.