DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ae1 and CYP72C1

DIOPT Version :9

Sequence 1:NP_525044.1 Gene:Cyp4ae1 / 31193 FlyBaseID:FBgn0015036 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:190 Identity:35/190 - (18%)
Similarity:59/190 - (31%) Gaps:69/190 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SVSRVPLLG-----AAWQMRS-----FQPDNLHDKFAEYVKRFG------RSFMGTV-------- 76
            :|.:|.|:|     ..|..|:     .:|..|.    :|:|:.|      |..||.:        
plant     6 TVRKVFLIGFLILILNWVWRAVNWVWLRPKRLE----KYLKKQGFSGNSYRILMGDMRESNQMDQ 66

  Fly    77 LGHVVMVTAEPRHIDALLQGQHQ--LKKGTMYFALRGWLG------------------------- 114
            :.|.:.:..:...:..::...|.  ||.|...|.   |.|                         
plant    67 VAHSLPLPLDADFLPRMMPFLHHTVLKHGKKCFT---WYGPYPNVIVMDPETLREIMSKHELFPK 128

  Fly   115 -----------DGLLLSRGKEWHTMRKIITPTFHFSILEQFVEVFDRQSSILVERLRTLS 163
                       .|||...|.:|...|.|:.|.|....|:..:..|:.....::|....|:
plant   129 PKIGSHNHVFLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERLA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ae1NP_525044.1 p450 35..486 CDD:278495 35/190 (18%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.