DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ae1 and CYP77B1

DIOPT Version :9

Sequence 1:NP_525044.1 Gene:Cyp4ae1 / 31193 FlyBaseID:FBgn0015036 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_172626.1 Gene:CYP77B1 / 837704 AraportID:AT1G11600 Length:510 Species:Arabidopsis thaliana


Alignment Length:511 Identity:118/511 - (23%)
Similarity:218/511 - (42%) Gaps:93/511 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VVPSVSRVPLLGAAWQMRSFQPDNLHDKFAEYVKRFGRSF---MGTVLGHVVMVTAEPRHIDALL 94
            :.|.....||:|...|: .||..:......:..|::|..|   ||.  ..::::|.|....:||:
plant    35 IPPGPKGWPLVGNLLQV-IFQRRHFVFLMRDLRKKYGPIFTMQMGQ--RTMIIITDEKLIHEALV 96

  Fly    95 QGQHQLKKGTMYFA------LRGWLGDGLLLSRGK----------EWHTMRK-IITPTFHFSILE 142
            |      :|..:.:      :|      |:.|.||          .|.|:|: .:|.......::
plant    97 Q------RGPTFASRPPDSPIR------LMFSVGKCAINSAEYGSLWRTLRRNFVTELVTAPRVK 149

  Fly   143 Q--FVEVFDRQSSILVERLRTLSYGNEVVNIYPLVGLAALDIITETAMGVNVDAQGADSEVVHAV 205
            |  ::..:..|:.  ::|::|.:.....|.:.....|....|:.....|..:..:        .:
plant   150 QCSWIRSWAMQNH--MKRIKTENVEKGFVEVMSQCRLTICSILICLCFGAKISEE--------KI 204

  Fly   206 KDLTNILATRFMRPHLLFPHLFRLCWPSGFRKQ--------QAGVICLHEFTNGIIEQRRRLL-A 261
            |::.|:|....:......|....:..|. ||:|        :..:.||..    :|..||:.: |
plant   205 KNIENVLKDVMLITSPTLPDFLPVFTPL-FRRQVREARELRKTQLECLVP----LIRNRRKFVDA 264

  Fly   262 REANQDKPTKP--HALLDTLLRATV--DGQPLTDKQIRDEVNTFIFEGHDTTTSAVSFCLYLLSR 322
            :|...::...|  .|.:|:|.|..:  .|..|.|::|....:..:..|.||:.:.:.:.|:.|..
plant   265 KENPNEEMVSPIGAAYVDSLFRLNLIERGGELGDEEIVTLCSEIVSAGTDTSATTLEWALFHLVT 329

  Fly   323 HEAVQQKLFEELRMHYGQDLFRGVI-LSDFATLPYLSCVVKESLRLYPPIP-AVARCLEKDLVID 385
            .:.:|:||:||:....|::   ||: ..|.|.:|||..:|||:||.:||.. .::....||..:.
plant   330 DQNIQEKLYEEVVGVVGKN---GVVEEDDVAKMPYLEAIVKETLRRHPPGHFLLSHAAVKDTELG 391

  Fly   386 EGY-IPVGTNVVVLLWQLLRDEAIFTDPLVFQPERHL----GEEAPRLSP--YSYIPFSAGPRNC 443
             || ||.|..|.:....:..:..|::||..|:|||.|    |.:|.....  .:.:||.||.|.|
plant   392 -GYDIPAGAYVEIYTAWVTENPDIWSDPGKFRPERFLTGGDGVDADWTGTRGVTMLPFGAGRRIC 455

  Fly   444 IGQKFALLEMKTMVTKVIRHYQLLPMGADVEP--------------SIKIVLRSKS 485
            ......:|.:..|:.::|..::.:|: .|..|              |:|..:||::
plant   456 PAWSLGILHINLMLARMIHSFKWIPV-PDSPPDPTETYAFTVVMKNSLKAQIRSRT 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ae1NP_525044.1 p450 35..486 CDD:278495 118/509 (23%)
CYP77B1NP_172626.1 CYP77_89 68..503 CDD:410698 107/468 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.