DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ae1 and CYP77A6

DIOPT Version :9

Sequence 1:NP_525044.1 Gene:Cyp4ae1 / 31193 FlyBaseID:FBgn0015036 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_187668.1 Gene:CYP77A6 / 820222 AraportID:AT3G10570 Length:513 Species:Arabidopsis thaliana


Alignment Length:532 Identity:124/532 - (23%)
Similarity:239/532 - (44%) Gaps:78/532 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALLVTRLVASLFRLAL--KELRHPLQGVVPSVSRVPLLGAAWQM-RSFQPDNLHDKFAEYV---- 65
            :|..|.|::||..|.|  :..:..:..:.|.....|::|..:|. ||.:      :|.|||    
plant    16 SLFYTILISSLVLLILTRRSAKSKIVKLPPGPPGWPVVGNLFQFARSGK------QFYEYVDDVR 74

  Fly    66 KRFGRSFMGTVLGHVVMVTAEPRHI-DALLQGQHQLKKGTMYFALRGWLGDGLLL---------- 119
            |::|..:...:....:::.::...: |.|:|      :|.| ||.|........:          
plant    75 KKYGPIYTLRMGSRTMIIISDSALVHDVLIQ------RGPM-FATRPTENPTRTIFSSNTFTVNA 132

  Fly   120 -SRGKEWHTMRKIITPTFHFSI-LEQFVEVFDRQSSI--LVERLRTLSYGNE-VVNIYPLVGLAA 179
             :.|..|.::||.:......|| ..:|..:  |||::  ||||:::.:..|: :|.:......||
plant   133 SAYGPVWRSLRKNMVQNMLSSIRFREFGSL--RQSAMDKLVERIKSEAKDNDGLVWVLRNARFAA 195

  Fly   180 LDIITETAMGVNVDAQGADSEVVHAVKDLTNILATRFMRPHL------LFPHLFRLCWPSGFRKQ 238
            ..|:.|...|:.:|    :..:::..:.:..:|.|  :.|.|      |.|.         :.|:
plant   196 FCILLEMCFGIEMD----EESILNMDQVMKKVLIT--LNPRLDDYLPILAPF---------YSKE 245

  Fly   239 QAGVICLH----EFTNGIIEQRRRLLAREANQDKPTKPHALLDTLLRATVDGQPLT--DKQIRDE 297
            :|..:.:.    :|...:||:|||.: ::...||.....:.||||.....:|:..|  ::::...
plant   246 RARALEVRCEQVDFIVKLIERRRRAI-QKPGTDKTASSFSYLDTLFDLKTEGRITTPSNEELVSL 309

  Fly   298 VNTFIFEGHDTTTSAVSFCLYLLSRHEAVQQKLFEELRMHYGQDLFRGVILSDFATLPYLSCVVK 362
            .:.|:..|.|||.:|:.:.:..|..:..:|.:|::|::...|.   |.|...|...:.:|..|||
plant   310 CSEFLNGGTDTTGTAIEWGIAQLIVNPEIQSRLYDEIKSTVGD---REVEEKDVDKMVFLQAVVK 371

  Fly   363 ESLRLYPPIPAVARCLEKDLVIDEGY-IPVGTNVVVLLWQLLRDEAIFTDPLVFQPERHLG--EE 424
            |.||.:||..........:.....|| :|||.||...|..:..|..:::||..|.|:|.:.  ||
plant   372 EILRKHPPTYFTLTHSVTEPTTVAGYDVPVGINVEFYLPGINEDPKLWSDPKKFNPDRFISGKEE 436

  Fly   425 A--PRLSPYSYIPFSAGPRNCIGQKFALLEMKTMVTKVIRHYQ--LLPMGADVE--PSIKIVLRS 483
            |  ..::....:||..|.|.|.|...|.:.:..|:.|:::.::  ..|..::::  ..::..:..
plant   437 ADITGVTGVKMMPFGIGRRICPGLAMATVHVHLMLAKMVQEFEWSAYPPESEIDFAGKLEFTVVM 501

  Fly   484 KSGVNVGLRPRL 495
            |..:...::||:
plant   502 KKPLRAMVKPRV 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ae1NP_525044.1 p450 35..486 CDD:278495 115/492 (23%)
CYP77A6NP_187668.1 PLN00168 55..512 CDD:215086 112/490 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.