DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ae1 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_525044.1 Gene:Cyp4ae1 / 31193 FlyBaseID:FBgn0015036 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:518 Identity:151/518 - (29%)
Similarity:256/518 - (49%) Gaps:51/518 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVVLLVALLVTRLVASLFRLALKELRHPLQGVVPSVSRVPLLGAAW---QMRSFQPDNLHDKFA 62
            :.:|..:||::.:.:    :|.|:.     |.::..:|..|...|.|   ..:..|.||: :...
Mouse    16 LALVFCLALVLMQAM----KLYLRR-----QRLLRDLSPFPGPPAHWLLGHQKFLQEDNM-ETLD 70

  Fly    63 EYVKRFGRSF---MGTVLGHVVMVTAEPRHI-----DALLQGQHQLKKGTMYFALRGWLGDGLLL 119
            |.||:...:|   :|.......:...:...|     |..:|..|||        |...:|.|||.
Mouse    71 EIVKKHPCAFPCWVGPFQAFFYIYDPDYAKIFLSRTDPKMQYLHQL--------LTPCIGRGLLN 127

  Fly   120 SRGKEWHTMRKIITPTFHFSILEQFVEVFDRQSSILVERLRTLSYGNE-VVNIYPLVGLAALDII 183
            ..|..|...|.::||.||..||:..|:.......:::::...:....| .:.::..:.|..||||
Mouse   128 LDGPRWFQHRCLLTPAFHQDILKPCVDTMAHSVKVMLDKWEKMWTTQETTIEVFEHINLMTLDII 192

  Fly   184 TETAMG--VNVDAQGADSEVVHAVKDLTNILATR---FMRPHLLFPHLFRLCWPSGFRKQQAGVI 243
            .:.|.|  .|....|.....|.|..:|..|:::|   |...|.:   :|:|. |.|...|:.|.:
Mouse   193 MKCAFGQETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDI---IFKLS-PKGHCFQELGKV 253

  Fly   244 CLHEFTNGIIEQRRRLLAREANQDKPTKPHALLDTLLRATV-DGQPLTDKQIRDEVNTFIFEGHD 307
             :|::|..||:.|:::|..:..||........||.:|.|.. |.:..:|..:|.|||||::.|||
Mouse   254 -IHQYTEKIIQDRKKILKNQVKQDDTQTSQIFLDIVLSAQAEDERAFSDADLRAEVNTFMWAGHD 317

  Fly   308 TTTSAVSFCLYLLSRHEAVQQKLFEELRMHYGQDLFRGVILSDFATLPYLSCVVKESLRLYPPIP 372
            .:.:::|:.||.|:.:...|.:...|:|...|..  ..:.......:.|.:..:||:|||.||:|
Mouse   318 ASAASISWLLYCLALNPEHQDRCRTEIRSILGDG--SSITWEQLDEMSYTTMCIKETLRLIPPVP 380

  Fly   373 AVARCLEKDLVIDEGY-IPVGTNVVVLLWQLLRDEAIFTDPLVFQPERHLGEEAPRLSPYSYIPF 436
            :::|.|.|.|.:.:|: :|.|..||:.:|.|..:.|::.||.||.|.|...|.:.:..|.:::||
Mouse   381 SISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWNDPKVFDPLRFTKENSDQRHPCAFLPF 445

  Fly   437 SAGPRNCIGQKFALLEMKTMVTKVIRHYQLLPMGADV-EP---SIKIVLRSKSGVNVGLRPRL 495
            |:||||||||:||:||:|..:..::.|:|:.|   |: .|   |...|||.|.|:.:.|:..|
Mouse   446 SSGPRNCIGQQFAMLELKVAIALILLHFQVAP---DLTRPPAFSSHTVLRPKHGIYLHLKKLL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ae1NP_525044.1 p450 35..486 CDD:278495 142/473 (30%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 142/470 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.