DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ae1 and Cyp4a1

DIOPT Version :9

Sequence 1:NP_525044.1 Gene:Cyp4ae1 / 31193 FlyBaseID:FBgn0015036 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_787031.1 Gene:Cyp4a1 / 50549 RGDID:68945 Length:509 Species:Rattus norvegicus


Alignment Length:500 Identity:151/500 - (30%)
Similarity:253/500 - (50%) Gaps:39/500 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VASLFRLALKELRHPL--QGVVPSVSRVPLLGAAWQM--RSFQPDNLHDKFAEYVKRFGRSFMGT 75
            |..|..|.:|.::..|  |.::.:..:.|.....|..  :.||.|....:....|:.|..:|...
  Rat    24 VLGLLLLLVKAVQFYLQRQWLLKAFQQFPSPPFHWFFGHKQFQGDKELQQIMTCVENFPSAFPRW 88

  Fly    76 VLG-HVVMVTAEPRHIDALLQGQHQLKKGTMYFALRGWLGDGLLLSRGKEWHTMRKIITPTFHFS 139
            ..| ...::..:|.::..:| |:...|...:|..|..|:|.||||..|:.|...|:::||.||:.
  Rat    89 FWGSKAYLIVYDPDYMKVIL-GRSDPKANGVYRLLAPWIGYGLLLLNGQPWFQHRRMLTPAFHYD 152

  Fly   140 ILEQFVEVFDRQSSILVERLRTLSYGNEVVNIYPLVGLAALDIITETAMGVN--VDAQGADSEVV 202
            ||:.:|:.......:::::...|:..:..:.|:..:.|..||.:.:.|...|  |...|.....:
  Rat   153 ILKPYVKNMADSIRLMLDKWEQLAGQDSSIEIFQHISLMTLDTVMKCAFSHNGSVQVDGNYKSYI 217

  Fly   203 HAVKDLTNILATR----FMRPHLLF-----PHLF-RLCWPSGFRKQQAGVICLHEFTNGIIEQRR 257
            .|:.:|.::..:|    |.:...::     .||| |.|       |.|     |:.|:|:|:.|:
  Rat   218 QAIGNLNDLFHSRVRNIFHQNDTIYNFSSNGHLFNRAC-------QLA-----HDHTDGVIKLRK 270

  Fly   258 RLLAREANQDKPTKPHAL--LDTLLRATVD-GQPLTDKQIRDEVNTFIFEGHDTTTSAVSFCLYL 319
            ..|......:|..|...|  ||.||.|.:: |..|:||.:|.||:||:|||||||.|.||:..|.
  Rat   271 DQLQNAGELEKVKKKRRLDFLDILLLARMENGDSLSDKDLRAEVDTFMFEGHDTTASGVSWIFYA 335

  Fly   320 LSRHEAVQQKLFEELRMHYGQDLFRGVILSDFATLPYLSCVVKESLRLYPPIPAVARCLEKDLVI 384
            |:.|...||:..||::...|..  ..:.......:||.:..:||:||||||:|.:.|.|...:..
  Rat   336 LATHPEHQQRCREEVQSVLGDG--SSITWDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTF 398

  Fly   385 DEG-YIPVGTNVVVLLWQLLRDEAIFTDPLVFQPERHLGEEAPRLSPYSYIPFSAGPRNCIGQKF 448
            .:| .:|.|..|.:.::.|..:..::.:|.||.|.| ...::||.| :|::|||.|.|||||::|
  Rat   399 PDGRSLPKGIQVTLSIYGLHHNPKVWPNPEVFDPSR-FAPDSPRHS-HSFLPFSGGARNCIGKQF 461

  Fly   449 ALLEMKTMVTKVIRHYQLLPMGADVE-PSIKIVLRSKSGVNVGLR 492
            |:.|||.:|...:..::|||....|. |..::||:||:|:.:.|:
  Rat   462 AMSEMKVIVALTLLRFELLPDPTKVPIPLPRLVLKSKNGIYLYLK 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ae1NP_525044.1 p450 35..486 CDD:278495 143/470 (30%)
Cyp4a1NP_787031.1 p450 52..503 CDD:278495 144/467 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.