DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ae1 and Cyp313b1

DIOPT Version :9

Sequence 1:NP_525044.1 Gene:Cyp4ae1 / 31193 FlyBaseID:FBgn0015036 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001287239.1 Gene:Cyp313b1 / 41019 FlyBaseID:FBgn0037601 Length:502 Species:Drosophila melanogaster


Alignment Length:468 Identity:128/468 - (27%)
Similarity:223/468 - (47%) Gaps:52/468 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ELRHPLQGVVPSVSRVPLLGAAWQMRSFQPDNLHDKFAEYVKRFGRSF-------MGTVLGHVVM 82
            :||.|:..        ||:|...||  ..|:.    |.:|:....|.|       |||   ...:
  Fly    31 QLRGPIGW--------PLIGMGLQM--MNPET----FLQYMDGLSRQFKAPFISWMGT---SCFL 78

  Fly    83 VTAEPRHIDALLQGQHQLKKGTMYFALRGWLGDGLLLSRGKEWHTMRKIITPTFHFSILEQFVEV 147
            ...:|..::.:|...|...||..|..:...:||||..|....||..|::|.|.|...||..|:.:
  Fly    79 YINDPHSVEQILNSTHCTNKGDFYRFMSSAIGDGLFTSSSPRWHKHRRLINPAFGRQILSNFLPI 143

  Fly   148 FDRQSSILVERLRT--LSYGNEVVNIYPLVGLAALDIITETAMGVNVDAQGADSE-VVHAVKDLT 209
            |:.::.:|:::|..  :.:|.. :.||.::....|:...:|.||..::.|...|. :..|...||
  Fly   144 FNAEAEVLLQKLELEGVQHGKR-LEIYQILKKIVLEAACQTTMGKKMNFQHDGSLCIFKAYNGLT 207

  Fly   210 NILATRFMRPHLLFPHLFRLCWPSG-FRKQQAGVICLHEFTNGIIEQRRRLLAREANQDKPT--- 270
            .:...|.:.|.|....::|   .|| ||.||..|..|..|...::|....::|..:|.|:..   
  Fly   208 EVCVKRMLSPWLYPDLIYR---RSGLFRLQQKVVGILFGFIEQLLEPIVSVVAANSNPDQQRSEM 269

  Fly   271 ----KPHALLDTLLRATVDGQPLTDKQIRDEVNTFIFEGHDTTTSAVSFCLYLLSRHEAVQQKLF 331
                |..|:....:|..|:...|:.:.:|||.|..|....:||::|:.|.:..|:.|...|:||.
  Fly   270 EMRGKSKAIFIEQVREHVERGQLSWQDVRDEANVTIAATFETTSTALYFTILCLAMHPCYQEKLH 334

  Fly   332 EEL--RMHYGQDLFRGVILSDFATLPYLSCVVKESLRLYPPIPAVARCLEKDLVIDEG----YIP 390
            :||  .:....|    :.|.....|.|...|:.|::||:.|:|.|.|..::|:.:..|    .||
  Fly   335 KELVTELPPSGD----INLEQLQRLEYTEMVINEAMRLFAPVPMVLRSADQDIQLKRGDGEFLIP 395

  Fly   391 VGTNVVVLLWQLLRDEAIFTDPL--VFQPERHLGEEAPRLSPYSYIPFSAGPRNCIGQKFALLEM 453
            .||.:.:.::.:.|||.:: .||  .:.|:.|.|.::|:...::::||:.|.|.|||.::|.:.|
  Fly   396 RGTQIGIDIYNMQRDERVW-GPLSRTYNPDAHFGLDSPQRHAFAFVPFTKGLRMCIGYRYAQMLM 459

  Fly   454 KTMVTKVIRHYQL 466
            |.::.::.|.|::
  Fly   460 KLLLARIFRSYRI 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ae1NP_525044.1 p450 35..486 CDD:278495 125/458 (27%)
Cyp313b1NP_001287239.1 p450 33..474 CDD:299894 127/466 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 1 0.950 - 0 Normalized mean entropy S4824
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
54.910

Return to query results.
Submit another query.