DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ae1 and Cyp4a3

DIOPT Version :9

Sequence 1:NP_525044.1 Gene:Cyp4ae1 / 31193 FlyBaseID:FBgn0015036 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_038965516.1 Gene:Cyp4a3 / 298423 RGDID:631356 Length:511 Species:Rattus norvegicus


Alignment Length:492 Identity:149/492 - (30%)
Similarity:251/492 - (51%) Gaps:25/492 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SLFRLALKELRHPL--QGVVPSVSRVPLLGAAWQMRSFQPDNLHDKFAEYVKRFGRSFMGTVLGH 79
            |||.:..|.::..|  |.::.::.:.|...:.|.......|....:...:|::|..:.:..:.|.
  Rat    26 SLFLVLFKAVQFYLRRQWLLKALEKFPSTPSHWLWGHDLKDREFQQVLTWVEKFPGACLQWLSGS 90

  Fly    80 VVMVTA-EPRHIDALLQGQHQLKKGTMYFALRGWL----GDGLLLSRGKEWHTMRKIITPTFHFS 139
            ...|.. :|.::..:| |:...|...:|..|..|:    |.||||..||:|....:::||.||:.
  Rat    91 KTRVLLYDPDYVKVVL-GRSDPKASGIYQFLAPWIVSGTGYGLLLLNGKKWFQHWRMLTPAFHYG 154

  Fly   140 ILEQFVEVFDRQSSILVERLRTLSYGNEVVNIYPLVGLAALDIITETAM----GVNVDAQGADSE 200
            ||:.:|::.....||::::...|...:..:.|:..|.|..||.:.:.|.    .|.:|..  ...
  Rat   155 ILKPYVKIMADSVSIMLDKWEKLDDQDHPLEIFHYVSLMTLDTVMKCAFSHQGSVQLDVN--SRS 217

  Fly   201 VVHAVKDLTNILATRFMRPHLLFPHLFRLCWPSGFRKQQAGVICLHEFTNGIIEQRRRLLAREAN 265
            ...||:||.|:  |.|......:.:.......|..|..:......||.|:|:|:.|:..|..|..
  Rat   218 YTKAVEDLNNL--TFFRVRSAFYGNSIIYNMSSDGRLSRRACQIAHEHTDGVIKMRKAQLQNEEE 280

  Fly   266 QDKPTKPHAL--LDTLLRATV-DGQPLTDKQIRDEVNTFIFEGHDTTTSAVSFCLYLLSRHEAVQ 327
            ..|..|...|  ||.||.|.: ||:.|:|:.:|.||:||:|||||||.|.:|:..|.|:.|...|
  Rat   281 LQKARKKRHLDFLDILLFAKMEDGKSLSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQ 345

  Fly   328 QKLFEELRMHYGQDLFRGVILSDFATLPYLSCVVKESLRLYPPIPAVARCLEKDLVIDEG-YIPV 391
            ::..||::...|..  ..|.......:.|.:..:||:||||||:|:|:|.|...:...:| .||.
  Rat   346 ERCREEVQSILGDG--TSVTWDHLDQISYTTMCIKEALRLYPPVPSVSRELSSPVTFPDGRSIPK 408

  Fly   392 GTNVVVLLWQLLRDEAIFTDPLVFQPERHLGEEAPRLSPYSYIPFSAGPRNCIGQKFALLEMKTM 456
            |....:|::.|..:.:.:.:|.||.|.| ...::||.| ::|:|||.|.|||||::||:.|:|..
  Rat   409 GITTTILIYGLHHNPSYWPNPKVFDPSR-FSPDSPRHS-HAYLPFSGGARNCIGKQFAMNELKVA 471

  Fly   457 VTKVIRHYQLLPMGADVE-PSIKIVLRSKSGVNVGLR 492
            |...:..::|||....:. |..::||:||:|:::.|:
  Rat   472 VALTLLRFELLPDPTRIPVPMARLVLKSKNGIHLRLK 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ae1NP_525044.1 p450 35..486 CDD:278495 141/464 (30%)
Cyp4a3XP_038965516.1 CYP4B-like 69..506 CDD:410771 139/445 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.