DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ae1 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_525044.1 Gene:Cyp4ae1 / 31193 FlyBaseID:FBgn0015036 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_663708.1 Gene:Cyp4x1 / 246767 RGDID:628719 Length:507 Species:Rattus norvegicus


Alignment Length:514 Identity:156/514 - (30%)
Similarity:258/514 - (50%) Gaps:49/514 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLVVLLVALLVTRLVASLFR--LALKELRHPLQGVVPSVSRVPLLGAAWQMRSFQPDNLHDKFAE 63
            :.:|..:||::.:.|....|  ..|::|| |..|  |:...  |||   ..:..|.||: :|..|
  Rat    16 LALVFCLALVLMQAVKLYLRRQRLLRDLR-PFPG--PTAHW--LLG---HQKFLQEDNM-EKLDE 71

  Fly    64 YVKRFGRSF---MGTVLGHVVMVTAEPRHI-----DALLQGQHQLKKGTMYFALRGWLGDGLLLS 120
            .||.:..:|   :|.......:...:...|     |...|..|||        :..:||.|||..
  Rat    72 IVKEYPCAFPCWVGPFQAFFYIYDPDYAKIFLSRTDPKTQYLHQL--------MTPFLGRGLLNL 128

  Fly   121 RGKEWHTMRKIITPTFHFSILEQFVEVFDRQSSILVERL-RTLSYGNEVVNIYPLVGLAALDIIT 184
            .|..|...|.::||.||..||:..|::.....::::::. :|.:.....:.::..:.|..||||.
  Rat   129 DGPRWFQHRCLLTPAFHQDILKPCVDMMAHSVNMMLDKWEKTWTTQETTIEVFEHINLMTLDIIM 193

  Fly   185 ETAMG--VNVDAQGADSEVVHAVKDLTNILATR---FMRPHLLFPHLFRLCWPSGFRKQQAGVIC 244
            :.|.|  .|....|.....|.|..:|..|:::|   |...|.:   :|:|. |.|...|:.|.: 
  Rat   194 KCAFGQETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDI---IFKLS-PKGHCFQELGKV- 253

  Fly   245 LHEFTNGIIEQRRRLLAREANQDKPTKPHALLDTLLRATV-DGQPLTDKQIRDEVNTFIFEGHDT 308
            :|:.|..||:.|::.|..:.|||........||.:|.|.. |.:..:|..:|.|||||::.|||.
  Rat   254 IHQCTEKIIQDRKKTLKDQVNQDDTQTSQNFLDIVLSAQAGDEKAFSDADLRSEVNTFMWAGHDA 318

  Fly   309 TTSAVSFCLYLLSRHEAVQQKLFEELRMHYGQDLFRGVILSDFATLPYLSCVVKESLRLYPPIPA 373
            :.:::|:.||.|:.:...|.:...|:|...|..  ..:.......:||.:..:||:|||.||||:
  Rat   319 SAASISWLLYCLALNPEHQDRCRTEIRSILGDG--SSITWEQLDEIPYTTMCIKETLRLIPPIPS 381

  Fly   374 VARCLEKDLVIDEGY-IPVGTNVVVLLWQLLRDEAIFTDPLVFQPERHLGEEAPRLSPYSYIPFS 437
            ::|.|.|.|.:.:|: :|.|..||:.:|.|..:.|::.||.||.|.|...|.:.:..|.:::|||
  Rat   382 ISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWKDPKVFDPLRFTKENSEQRHPCAFLPFS 446

  Fly   438 AGPRNCIGQKFALLEMKTMVTKVIRHYQLLPMGADV-EP---SIKIVLRSKSGVNVGLR 492
            :||||||||:||:||:|..:...:..::   :.||: .|   |...|||.|.|:.:.|:
  Rat   447 SGPRNCIGQQFAMLELKVAIALTLLRFR---VAADLTRPPAFSSHTVLRPKHGIYLHLK 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ae1NP_525044.1 p450 35..486 CDD:278495 144/470 (31%)
Cyp4x1NP_663708.1 CYP4B-like 66..500 CDD:410771 138/452 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D249473at33208
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.