DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and CYP702A1

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_176744.1 Gene:CYP702A1 / 842878 AraportID:AT1G65670 Length:482 Species:Arabidopsis thaliana


Alignment Length:519 Identity:120/519 - (23%)
Similarity:208/519 - (40%) Gaps:101/519 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLVAFATLLLWDFLW------RRRGNGILPGPRPLPFLGNLLMY-RGLDPEQIMDFVKKNQRKY 65
            ||.|..:.:::..|.|      .:....:.||....|.:|....: :..|..|...|:|:...:|
plant     7 LLTVMVSLIVVKLFHWIYQSKNPKPNEKLPPGSMGFPIIGETFEFMKPHDAFQFPTFIKERIIRY 71

  Fly    66 GRLYRVWILHQLAVFSTDPRDIEFVLSSQQHITKNN----LYKLLNCWLGDGLLMSTGRKWHGRR 126
            |.::|..:.....:.|||       :.....|.|.|    |.|.:....|:..|....::.|...
plant    72 GPIFRTSLFGAKVIISTD-------IELNMEIAKTNHAPGLTKSIAQLFGENNLFFQSKESHKHV 129

  Fly   127 KIITPTFHFKILE------QFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDI---IAE 182
            :.:|    |::|.      ..::..|..:...:|:...|.            ||...:|   |..
plant   130 RNLT----FQLLGSQGLKLSVMQDIDLLTRTHMEEGARRG------------CLDVKEISSKILI 178

  Fly   183 TAMGTKINAQKNPNLPYVQAVNDVTNILIKRFIHAWQRVDWIFRLTQP-TEAKRQDKAIK-VMHD 245
            ..:..|:.....|     :|..::. :..:.|...|.|    |.|..| |...:..||.| ::|.
plant   179 ECLAKKVTGDMEP-----EAAKELA-LCWRCFPSGWFR----FPLNLPGTGVYKMMKARKRMLHL 233

  Fly   246 FTENIIRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTIDGA-PLSDEDIREEVDTFM 309
            ..|.|:::|          .:.||    ||:         ..:...:|| .:|.::..|.:.|..
plant   234 LKETILKKR----------ASGEE----LGE---------FFKIIFEGAETMSVDNAIEYIYTLF 275

  Fly   310 FEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVL-GE-DRKSPVTLRDLGELKFMENVIKESL 372
            ...::||...::..:..||.:|:|.:.|.:|...:: |: ::::.:|..:...:.|.:.||.|||
plant   276 LLANETTPRILAATIKLISDNPKVMKELHREHEGIVRGKTEKETSITWEEYKSMTFTQMVINESL 340

  Fly   373 RLHPPVPMIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPDEFRPERFDA-DVPQIHP 436
            |:....|.:.|.|..:.::....||||..| ||......:|:.::.|..|.|.|::. |:..|..
plant   341 RITSTAPTVFRIFDHEFQVGSYKIPAGWIF-MGYPNNHFNPKTYDDPLVFNPWRWEGKDLGAIVS 404

  Fly   437 YAYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFELLPLGPEPRHSM--------NIVLRSANG 492
            ..||||.||.|.|:|.:||.|:|...:..|.|          .|.||        |.||...||
plant   405 RTYIPFGAGSRQCVGAEFAKLQMAIFIHHLSR----------DRWSMKIGTTILRNFVLMFPNG 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 115/489 (24%)
CYP702A1NP_176744.1 p450 8..440 CDD:386267 112/498 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.