| Sequence 1: | NP_001284806.1 | Gene: | Cyp4d2 / 31192 | FlyBaseID: | FBgn0011576 | Length: | 501 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001319024.1 | Gene: | CYP72C1 / 838276 | AraportID: | AT1G17060 | Length: | 313 | Species: | Arabidopsis thaliana |
| Alignment Length: | 196 | Identity: | 45/196 - (22%) |
|---|---|---|---|
| Similarity: | 73/196 - (37%) | Gaps: | 44/196 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MLGVVGV--LLLVAFATLLL---W---DFLWRR-------------RGNG--ILPGPR------- 35
Fly 36 ------PLPFLGNLLMYRGLDPEQIMDFVKKNQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQ 94
Fly 95 QHITKNNLYKLLNCWLGDGLLMSTGRKWHGRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSR 159
Fly 160 A 160 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cyp4d2 | NP_001284806.1 | p450 | 32..495 | CDD:278495 | 31/142 (22%) |
| CYP72C1 | NP_001319024.1 | None | |||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 170 | 1.000 | Inparanoid score | I1543 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000016 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_100014 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X23 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.860 | |||||