DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and CYP71B14

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_197900.1 Gene:CYP71B14 / 832589 AraportID:AT5G25180 Length:496 Species:Arabidopsis thaliana


Alignment Length:512 Identity:124/512 - (24%)
Similarity:214/512 - (41%) Gaps:80/512 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVGVLLLVAFATLLLWDFLWRRRGNGILPGPRPLPFLGNLLMYRGLDPEQIMDFVKKNQRKYGRL 68
            :||.....|| .|:..|  .|.....:.|||..||.:|||... |..|::.:   .|...|||.|
plant     6 IVGASFFFAF-ILIAKD--TRTTKKNLPPGPPRLPIIGNLHQL-GSKPQRSL---FKLSEKYGSL 63

  Fly    69 YRVWILHQLAVFSTDPRDIEFVLS-------SQQHITKNNLYKLLNCWLGDGLLMSTGRK-WHGR 125
            ..:...:..||.::.|..::.||.       |:.::|    |.....:..:.|..|...| |...
plant    64 MSLKFGNVSAVVASTPETVKDVLKTFDAECCSRPYMT----YPARVTYNFNDLAFSPYSKYWREV 124

  Fly   126 RKI-ITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDIIAETAMGTKI 189
            ||: :...:..|.::.|..:..::.|..|:.::..|.....:|:...:...:..:|.:...|..:
plant   125 RKMTVIELYTAKRVKSFQNVRQEEVASFVDFIKQHASLEKTVNMKQKLVKLSGSVICKVGFGISL 189

  Fly   190 NAQKNPNLPYVQAVNDVTNILIKRFIHA------WQRVDWIFRLTQPTEAKRQDKAIKVMHDFTE 248
            ...|..| .|.:.:.....: :.||..|      .:.:|.|..|....|     |..|.|..|.:
plant   190 EWSKLAN-TYEEVIQGTMEV-VGRFAAADYFPIIGRIIDRITGLHSKCE-----KVFKEMDSFFD 247

  Fly   249 NIIRERRE----------TLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTIDGAPLSDEDIRE 303
            ..|:...|          .|:...|..|...|........:..||:||:                
plant   248 QSIKHHLEDTNIKDDIIGLLLKMEKGETGLGEFQLTRNHTKGILLNVLI---------------- 296

  Fly   304 EVDTFMFEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVI 368
                   .|.||:...:::.:..:.::|.|.::.|.|:|:|:  ..|..:|..|:..|::::.||
plant   297 -------AGVDTSGHTVTWVMTHLIKNPRVMKKAQAEVREVI--KNKDDITEEDIERLEYLKMVI 352

  Fly   369 KESLRLHPPVP-MIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPDEFRPERF---DA 429
            ||:||::|.|| :|.|..::.::|.|..||..|...:.|:.:.|:|..::.|:.|.||||   :.
plant   353 KETLRINPLVPLLIPREASKYIKIGGYDIPKKTWIYVNIWAVQRNPNVWKDPEVFIPERFMHSEI 417

  Fly   430 DVPQIHPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFE-LLPLGPEPRHSMNI 485
            |...: .:..:||.:|.|.|.|....|..:..|:..||..|: .||.|      |||
plant   418 DYKGV-DFELLPFGSGRRMCPGMGLGMALVHLTLINLLYRFDWKLPEG------MNI 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 117/484 (24%)
CYP71B14NP_197900.1 p450 1..490 CDD:386267 124/512 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.