DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and CYP714A2

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_197872.1 Gene:CYP714A2 / 832559 AraportID:AT5G24900 Length:525 Species:Arabidopsis thaliana


Alignment Length:535 Identity:128/535 - (23%)
Similarity:228/535 - (42%) Gaps:114/535 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WRRRGN----GILPGPRPLPFLGNLLMYRGLDPE----------------QIMDFVKKNQRKYGR 67
            ||.|.:    |: .||.|..|.||:...:.:..|                .:.......:::|||
plant    36 WRMRRSLKLQGV-KGPPPSIFNGNVSEMQRIQSEAKHCSGDNIISHDYSSSLFPHFDHWRKQYGR 99

  Fly    68 LY--------RVWILH-----QLAVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGDGLLMSTG 119
            :|        .::|.|     :|:..:|      ..|....||||.     ||..||:|::.|.|
plant   100 IYTYSTGLKQHLYINHPEMVKELSQTNT------LNLGRITHITKR-----LNPILGNGIITSNG 153

  Fly   120 RKWHGRRKIITPTFHFKILEQFVEIFDQQSAVMV---EQLQSRADGM-TPINIFPVICLTALDII 180
            ..|..:|:||...|....::..|.:..:.:..|:   |::..|...| ..|.:...:...:.|:|
plant   154 PHWAHQRRIIAYEFTHDKIKGMVGLMVESAMPMLNKWEEMVKRGGEMGCDIRVDEDLKDVSADVI 218

  Fly   181 AETAMGTKINAQKNPNLPYVQAVNDVTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAIKVMHD 245
            |:...|:..:..|    .....:.|:...:.||.:        :||                .:.
plant   219 AKACFGSSFSKGK----AIFSMIRDLLTAITKRSV--------LFR----------------FNG 255

  Fly   246 FTENIIRERRE----------TLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTIDGAPLSDED 300
            ||:.:...::.          .|.::..||..|.|:......::     .|:|..::||..|.:.
plant   256 FTDMVFGSKKHGDVDIDALEMELESSIWETVKEREIECKDTHKK-----DLMQLILEGAMRSCDG 315

  Fly   301 -----------IREEVDTFMFEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVT 354
                       :.:...:..|.|||:|..::|:||..::.:|..|.:::.||   |...:.....
plant   316 NLWDKSAYRRFVVDNCKSIYFAGHDSTAVSVSWCLMLLALNPSWQVKIRDEI---LSSCKNGIPD 377

  Fly   355 LRDLGELKFMENVIKESLRLHPPVPMIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESP 419
            ...:..||.:..||:|::||:||.|::||..::|:.:....:|.|......|..|.||||.: .|
plant   378 AESIPNLKTVTMVIQETMRLYPPAPIVGREASKDIRLGDLVVPKGVCIWTLIPALHRDPEIW-GP 441

  Fly   420 D--EFRPERFDADVPQI--HPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFELLPLGPEPR 480
            |  :|:||||...:.:.  :|.:||||..|||.|:|:.|.|:|:|..||.::..|. ..|.|..:
plant   442 DANDFKPERFSEGISKACKYPQSYIPFGLGPRTCVGKNFGMMEVKVLVSLIVSKFS-FTLSPTYQ 505

  Fly   481 HSMN--IVLRSANGV 493
            ||.:  :::...:||
plant   506 HSPSHKLLVEPQHGV 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 124/522 (24%)
CYP714A2NP_197872.1 p450 37..524 CDD:299894 127/534 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.