DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and CYP702A5

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001078393.1 Gene:CYP702A5 / 827206 AraportID:AT4G15393 Length:467 Species:Arabidopsis thaliana


Alignment Length:540 Identity:117/540 - (21%)
Similarity:208/540 - (38%) Gaps:154/540 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLLLVAFATLLLWDFLWRR-RGNGIL-PGPRPLPFLGNLLMYRGL-DPEQIMDFVKKNQRKYGRL 68
            |::.:....|..|.:.|:. :|||.| ||....|.:|....:..| |..|:..|||:...::|.:
plant    10 VIVSLIVVKLCHWIYQWKNPKGNGKLPPGSMGYPIIGETFEFMKLHDAIQLPTFVKEKLLRHGPV 74

  Fly    69 YRVWILHQLAVFSTD----------------PRDIEFVLSSQQHITKNNLYK----LLNCWLGD- 112
            :|..:.....:.|||                |:.:|.:..:.......:.:|    |.|.:||. 
plant    75 FRTSLFGGKVIISTDIGLNMEIAKTNHIPGMPKSLERLFGATNLFVNKDTHKHARSLTNQFLGSQ 139

  Fly   113 ----------GLLMSTGRKWHGRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPIN 167
                      ..|..|..| .|.||            ..:::.:..|.:::|             
plant   140 ALKLRMIQDIDFLARTHMK-EGARK------------GCLDVKETASKIVIE------------- 178

  Fly   168 IFPVICLTALDIIAETAMGTKINAQKNPNLPYVQAVNDVTNILIKRFIHAWQRVDW------IFR 226
                 ||:           .|:..:..|     :|..::| :....|...|.|..|      ::|
plant   179 -----CLS-----------KKVMGEMEP-----EAAKELT-LCWTFFPRDWFRFAWNFPGTGVYR 221

  Fly   227 LTQPTEAKRQDKAIKVMHDFTENIIRERR---------ETLVNNSKETTPEEEVNFLGQKRRMAL 282
            :     .|.:::.:||:   .|.::::|.         ||:..:::..|                
plant   222 I-----VKARNRMMKVI---KETVVKKRASGKKLGEFFETIFGDTESVT---------------- 262

  Fly   283 LDVLLQSTIDGAPLSDEDIREEVDTFMFEGHDTTTSAISFCLYEISRHPEVQQRLQQE----IRD 343
                         :|.|...|.:.|.....::||...::..:..||.:|:|.|.|::|    ::|
plant   263 -------------MSIEIATEYIFTLFVLANETTPGVLAATIKLISDNPKVMQELRREHEGIVQD 314

  Fly   344 VLGEDRKSPVTLRDLGELKFMENVIKESLRLHPPVPMIGRWFAEDVEIRGKHIPAGTNFTMGIFV 408
            .:.:|..:.:|..|...:.|.:.||.||||:...||.:.|....:::.....||||..| ||...
plant   315 KIKKDETADLTWEDYKSMTFTQMVINESLRITSTVPTVLRIIDHEIQFGDYTIPAGWIF-MGYPY 378

  Fly   409 LLRDPEYFESPDEFRPERFDA-DVPQIHPYAYIPFSAGPRNCIGQKFAMLEMKSTV--------- 463
            :..:||.::.|..|.|.|:.. |:..|....|:||.:|.|.|:|.:|..|:|...:         
plant   379 VHFNPEKYDDPLAFNPWRWKGKDLSTIVSKTYLPFGSGTRLCVGAEFVKLQMAIFIHHLFRYRWS 443

  Fly   464 ----SKLLRHFEL-LPLGPE 478
                :.|||.|.| ||.|.:
plant   444 MKAETTLLRRFILVLPRGSD 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 109/513 (21%)
CYP702A5NP_001078393.1 p450 30..448 CDD:386267 105/503 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.