DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and CYP702A8

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_189648.1 Gene:CYP702A8 / 822729 AraportID:AT3G30290 Length:408 Species:Arabidopsis thaliana


Alignment Length:446 Identity:107/446 - (23%)
Similarity:176/446 - (39%) Gaps:99/446 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FLGNLLMYRGLDPEQIMDFVKKNQ-----RKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHIT 98
            |.|.:::  .:|.|..|:..|.|:     :...||           |..|               
plant    10 FGGKVII--SMDNELNMEMAKTNRTPGITKSIARL-----------FGED--------------- 46

  Fly    99 KNNLYKLLNCWLGDGLLMSTGRKWHGRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGM 163
             |||:           |.||....|.|...:.......:..:.:|..|..:...:|  :...||.
plant    47 -NNLF-----------LQSTESHKHVRNLTVQMLGSQSLKLRIMENIDLLTRTHME--EGARDGS 97

  Fly   164 TPINIFPVICLTALDIIAETAMGTKINAQKNPNLPYVQAVNDVTNILIKRFIHAWQRVDW----- 223
            ..:.      .|...|:.| .:..|:..:..|     :|...:. :..:.|...|.|:.:     
plant    98 LDVK------ETTSKILIE-CLAKKVMGEMEP-----EAAKKLA-LCWRYFPSGWFRLPFNLPGI 149

  Fly   224 -IFRLTQPTEAKRQDKAIKVMHDFTENIIRERR--ETLVNNSKETTPEEEVNFLGQKRRMALLDV 285
             ::.:   .:|:::.|.:     ..|.::::|.  |.....||....|:|    |:|..|::.:|
plant   150 GVYNM---MKARKRMKTL-----LKEEVLKKREAGEEFGEFSKIIFGEKE----GEKETMSMKNV 202

  Fly   286 LLQSTIDGAPLSDEDIREEVDTFMFEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVL-GEDR 349
            :                |.:.||....::||...::..:..||.:|:|.|.||:|...:. .:..
plant   203 I----------------EYIYTFFVIANETTPRILAATVKFISENPKVMQELQREHAMIFENKSE 251

  Fly   350 KSPVTLRDLGELKFMENVIKESLRLHPPVPMIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPE 414
            ::.:|..|...:.|...||.||||:...||:|.|....|.::....||||.|| ||......||.
plant   252 EAGLTWEDYKSMTFTNMVINESLRISTTVPVILRKPDHDTKVGDYTIPAGWNF-MGYPSAHFDPT 315

  Fly   415 YFESPDEFRPERFDA-DVPQIHPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRH 469
            .:|.|.||.|.|:.. |:..|....||||.||||.|:|..||.|.|...:..|.|:
plant   316 KYEDPLEFNPWRWKGNDLDAIVSTNYIPFGAGPRLCVGAYFAKLLMAIFIHHLCRY 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 107/446 (24%)
CYP702A8NP_189648.1 p450 5..374 CDD:299894 107/446 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.