DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:509 Identity:173/509 - (33%)
Similarity:263/509 - (51%) Gaps:34/509 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LGVVGVLLLVAFATLLLWDFLWRRRGNGIL------PGPRPLPFLGNLLMYRGLDPEQIMDFVKK 60
            |.:|..|.||....:.|  :|.|:|   :|      |||.....||:....:..:.|.:.:.|| 
Mouse    16 LALVFCLALVLMQAMKL--YLRRQR---LLRDLSPFPGPPAHWLLGHQKFLQEDNMETLDEIVK- 74

  Fly    61 NQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGDGLLMSTGRKWHGR 125
               |:...:..|:....|.|.....|...:..|:.......|::||...:|.|||...|.:|...
Mouse    75 ---KHPCAFPCWVGPFQAFFYIYDPDYAKIFLSRTDPKMQYLHQLLTPCIGRGLLNLDGPRWFQH 136

  Fly   126 RKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSR-ADGMTPINIFPVICLTALDIIAETAMGTKI 189
            |.::||.||..||:..|:.......||:::.:.. ....|.|.:|..|.|..||||.:.|.|.:.
Mouse   137 RCLLTPAFHQDILKPCVDTMAHSVKVMLDKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQET 201

  Fly   190 NAQKNPNL-PYVQAVNDVTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAIKVMHDFTENIIRE 253
            |.|.|... .||:|..::..|:..|..:.|...|.||:|: |.....|:.. ||:|.:||.||::
Mouse   202 NCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKLS-PKGHCFQELG-KVIHQYTEKIIQD 264

  Fly   254 RRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTI-DGAPLSDEDIREEVDTFMFEGHDTTT 317
            |::.|.|..|:...:....|         ||::|.:.. |....||.|:|.||:|||:.|||.:.
Mouse   265 RKKILKNQVKQDDTQTSQIF---------LDIVLSAQAEDERAFSDADLRAEVNTFMWAGHDASA 320

  Fly   318 SAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESLRLHPPVPMIG 382
            ::||:.||.::.:||.|.|.:.|||.:||:.  |.:|...|.|:.:....|||:|||.||||.|.
Mouse   321 ASISWLLYCLALNPEHQDRCRTEIRSILGDG--SSITWEQLDEMSYTTMCIKETLRLIPPVPSIS 383

  Fly   383 RWFAEDVEIRGKH-IPAGTNFTMGIFVLLRDPEYFESPDEFRPERFDAD-VPQIHPYAYIPFSAG 445
            |..::.:.:...| :|||....:.|:.|..:|..:..|..|.|.||..: ..|.||.|::|||:|
Mouse   384 RELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWNDPKVFDPLRFTKENSDQRHPCAFLPFSSG 448

  Fly   446 PRNCIGQKFAMLEMKSTVSKLLRHFELLP-LGPEPRHSMNIVLRSANGVHLGLK 498
            |||||||:|||||:|..::.:|.||::.| |...|..|.:.|||..:|::|.||
Mouse   449 PRNCIGQQFAMLELKVAIALILLHFQVAPDLTRPPAFSSHTVLRPKHGIYLHLK 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 160/468 (34%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 160/468 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.