DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d2 and CYP71A13

DIOPT Version :9

Sequence 1:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_180635.3 Gene:CYP71A13 / 817628 AraportID:AT2G30770 Length:497 Species:Arabidopsis thaliana


Alignment Length:513 Identity:128/513 - (24%)
Similarity:221/513 - (43%) Gaps:76/513 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLGVVGVLLLVAFATLLLWDFLWRRRGN-GILPGPRPLPFLGNLLMYRGLDPEQIMDFVKKNQRK 64
            |:..:.:.|......|||..||.|.... .:.|.|..||.:|||... .|.|.:.:   :....:
plant     3 MILSISLCLTTLITLLLLRRFLKRTATKVNLPPSPWRLPVIGNLHQL-SLHPHRSL---RSLSLR 63

  Fly    65 YGRLYRVWILH----QLAVFSTDPRDIEFVLSSQQHITKNN-----LYKLLNCWLG--DGLLMST 118
            ||.|   .:||    .:.|.|:.....| ||.:..|...|.     ::.|:|   |  |.:....
plant    64 YGPL---MLLHFGRVPILVVSSGEAAQE-VLKTHDHKFANRPRSKAVHGLMN---GGRDVVFAPY 121

  Fly   119 GRKWHGRRKI-ITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDIIAE 182
            |..|...:.: |......|::|.|.::.:.:...|:|:|:..:...:..|:..:......|:.:.
plant   122 GEYWRQMKSVCILNLLTNKMVESFEKVREDEVNAMIEKLEKASSSSSSENLSELFITLPSDVTSR 186

  Fly   183 TAMGTKINAQKNPNLPYVQAVNDVTNIL----IKRF--IHAWQRVDWIFRLTQPTEAKRQDKAIK 241
            .|:|.| :::........:.|..:..:|    |..:  |.||  :|.|.......:     :..:
plant   187 VALGRK-HSEDETARDLKKRVRQIMELLGEFPIGEYVPILAW--IDGIRGFNNKIK-----EVSR 243

  Fly   242 VMHDFTENIIRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTID---GAPLSDEDIRE 303
            ...|..:.:::|..|  .:|.|..                .:|:||....|   |..:...||:.
plant   244 GFSDLMDKVVQEHLE--ASNDKAD----------------FVDILLSIEKDKNSGFQVQRNDIKF 290

  Fly   304 EVDTFMFEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVI 368
            .:......|..||::.:.:.:.|:.|.|:..::||.|||..: ....|.:..:::..:|:::.||
plant   291 MILDMFIGGTSTTSTLLEWTMTELIRSPKSMKKLQDEIRSTI-RPHGSYIKEKEVENMKYLKAVI 354

  Fly   369 KESLRLHPPVPMI-GRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPD--EFRPER---- 426
            ||.|||||.:||| .|..:|||:::|.:|.|||...:..:.:.||...: .||  ||:|||    
plant   355 KEVLRLHPSLPMILPRLLSEDVKVKGYNIAAGTEVIINAWAIQRDTAIW-GPDAEEFKPERHLDS 418

  Fly   427 -FDADVPQIHPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHF----ELLPLGPEP 479
             .|.....::   ||||.:|.|.|.|...|:...:.||:.|:..|    |..|.|.:|
plant   419 GLDYHGKNLN---YIPFGSGRRICPGINLALGLAEVTVANLVGRFDWRVEAGPNGDQP 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 120/481 (25%)
CYP71A13NP_180635.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.